MOBKL2A Antibody

Images

 
Western Blot: MOBKL2A Antibody [NBP1-68979] - THP-1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MOBKL2A Antibody [NBP1-68979] - HEK293 cells, concentration 1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOBKL2A Antibody Summary

Immunogen
Synthetic peptides corresponding to MOBKL2A (MOB1, Mps One Binder kinase activator-like 2A (yeast)) The peptide sequence was selected from the middle region of MOBKL2A. Peptide sequence EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOB3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MOBKL2A and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MOBKL2A Antibody

  • MOB LAK
  • Mob1 homolog 2A
  • MOB1, Mps One Binder kinase activator-like 2A (yeast)
  • MOB3A
  • moblak
  • MOB-LAKmps one binder kinase activator-like 2A
  • Protein Mob3A

Background

MOBKL2A may regulate the activity of kinases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2267
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-91978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02843
Species: Hu
Applications: WB, Flow, ICC/IF
AF5758
Species: Hu
Applications: WB, IHC, ICC
NB200-199
Species: Hu, Mu
Applications: WB, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3998
Species: Hu
Applications: WB
NBP1-81763
Species: Hu
Applications: IHC, IHC-P

Publications for MOBKL2A Antibody (NBP1-68979) (0)

There are no publications for MOBKL2A Antibody (NBP1-68979).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOBKL2A Antibody (NBP1-68979) (0)

There are no reviews for MOBKL2A Antibody (NBP1-68979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOBKL2A Antibody (NBP1-68979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOBKL2A Products

Bioinformatics Tool for MOBKL2A Antibody (NBP1-68979)

Discover related pathways, diseases and genes to MOBKL2A Antibody (NBP1-68979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MOBKL2A

There are no specific blogs for MOBKL2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOBKL2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOB3A
Uniprot