![Western Blot: METTL7A Antibody [NBP3-04948] - Analysis of extracts of 22Rv1 cells, using METTL7A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit](http://images.novusbio.com/fullsize/METTL7A-Antibody-Western-Blot-NBP3-04948-img0004.jpg "Western Blot: METTL7A Antibody [NBP3-04948] - Analysis of extracts of 22Rv1 cells, using METTL7A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit METTL7A Antibody - BSA Free (NBP3-04948) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-244 of human METTL7A (NP_054752.3). WICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMT1A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMT1A |
![Immunocytochemistry/Immunofluorescence: METTL7A Antibody [NBP3-04948] - Analysis of L929 cells using METTL7A Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/METTL7A-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-04948-img0005.jpg "Immunocytochemistry/Immunofluorescence: METTL7A Antibody [NBP3-04948] - Analysis of L929 cells using METTL7A Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: METTL7A Antibody [NBP3-04948] - Human liver using METTL7A Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/METTL7A-Antibody-Immunohistochemistry-Paraffin-NBP3-04948-img0007.jpg "Immunohistochemistry-Paraffin: METTL7A Antibody [NBP3-04948] - Human liver using METTL7A Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: METTL7A Antibody [NBP3-04948] - Human liver cancer using METTL7A Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/METTL7A-Antibody-Immunohistochemistry-Paraffin-NBP3-04948-img0006.jpg "Immunohistochemistry-Paraffin: METTL7A Antibody [NBP3-04948] - Human liver cancer using METTL7A Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: METTL7A Antibody - BSA Free [METTL7A] - Immunofluorescence analysis of HepG2 cells using METTL7A Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-04948_rabbit-polyclonal-mettl7a-antibody-52202516321414.jpg "Immunocytochemistry/ Immunofluorescence: METTL7A Antibody - BSA Free [METTL7A] - Immunofluorescence analysis of HepG2 cells using METTL7A Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")