Methionine Aminopeptidase 1D/MAP1D Antibody


Western Blot: Methionine Aminopeptidase 1D/MAP1D Antibody [NBP2-48593] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression more
Immunocytochemistry/ Immunofluorescence: Methionine Aminopeptidase 1D/MAP1D Antibody [NBP2-48593] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in more
Immunohistochemistry-Paraffin: Methionine Aminopeptidase 1D/MAP1D Antibody [NBP2-48593] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Methionine Aminopeptidase 1D/MAP1D Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA
Specificity of human Methionine Aminopeptidase 1D/MAP1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Methionine Aminopeptidase 1D/MAP1D Recombinant Protein Antigen (NBP2-48593PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Methionine Aminopeptidase 1D/MAP1D Antibody

  • EC
  • MAP1D
  • MAP1DCDS of metAP-3 within PCR fragment
  • MetAP1D
  • Metap1l
  • Methionine Aminopeptidase 1D
  • methionine aminopeptidase 1D, mitochondrial
  • methionyl aminopeptidase type 1D (mitochondrial)
  • Methionyl aminopeptidase type 1D, mitochondrial


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Methionine Aminopeptidase 1D/MAP1D Antibody (NBP2-48593) (0)

There are no publications for Methionine Aminopeptidase 1D/MAP1D Antibody (NBP2-48593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methionine Aminopeptidase 1D/MAP1D Antibody (NBP2-48593) (0)

There are no reviews for Methionine Aminopeptidase 1D/MAP1D Antibody (NBP2-48593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Methionine Aminopeptidase 1D/MAP1D Antibody (NBP2-48593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Methionine Aminopeptidase 1D/MAP1D Antibody (NBP2-48593)

Discover related pathways, diseases and genes to Methionine Aminopeptidase 1D/MAP1D Antibody (NBP2-48593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Methionine Aminopeptidase 1D/MAP1D

There are no specific blogs for Methionine Aminopeptidase 1D/MAP1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Methionine Aminopeptidase 1D/MAP1D Antibody and receive a gift card or discount.


Gene Symbol METAP1D