Membralin Antibody

Images

 
Western Blot: Membralin Antibody [NBP1-90088] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Membralin Antibody [NBP1-90088] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Membralin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IKFELDIEPKVFKPPSSTEALNDSQEFPFPETPTKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C19ORF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Membralin Protein (NBP1-90088PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Membralin Antibody

  • ASBABP1
  • aspecific BCL2 ARE-binding protein 1
  • chromosome 19 open reading frame 6
  • MBRL
  • MEMBRALIN
  • MGC4022
  • R32184_3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52062
Species: Hu
Applications: WB, PEP-ELISA
NBP2-30928
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00116443-R01
Species: Hu
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-04611
Species: Hu
NBP1-90088
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Membralin Antibody (NBP1-90088) (0)

There are no publications for Membralin Antibody (NBP1-90088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Membralin Antibody (NBP1-90088) (0)

There are no reviews for Membralin Antibody (NBP1-90088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Membralin Antibody (NBP1-90088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Membralin Products

Bioinformatics Tool for Membralin Antibody (NBP1-90088)

Discover related pathways, diseases and genes to Membralin Antibody (NBP1-90088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Membralin Antibody (NBP1-90088)

Discover more about diseases related to Membralin Antibody (NBP1-90088).
 

Pathways for Membralin Antibody (NBP1-90088)

View related products by pathway.

Blogs on Membralin

There are no specific blogs for Membralin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Membralin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C19ORF6