MCCD1 Antibody


Immunohistochemistry: MCCD1 Antibody [NBP2-47382] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MCCD1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQ
Specificity of human MCCD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for MCCD1 Antibody (NBP2-47382) (0)

There are no publications for MCCD1 Antibody (NBP2-47382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCCD1 Antibody (NBP2-47382) (0)

There are no reviews for MCCD1 Antibody (NBP2-47382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MCCD1 Antibody (NBP2-47382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MCCD1 Products

Array NBP2-47382

Bioinformatics Tool for MCCD1 Antibody (NBP2-47382)

Discover related pathways, diseases and genes to MCCD1 Antibody (NBP2-47382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MCCD1

There are no specific blogs for MCCD1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MCCD1 Antibody and receive a gift card or discount.


Gene Symbol MCCD1
Novus 100% Guarantee