MAN2A2 Antibody - Azide and BSA Free

Western Blot: MAN2A2 Antibody [NBP3-15749] - Western blot analysis of extracts of U-87MG cells, using MAN2A2 antibody (NBP3-15749) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAN2A2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MAN2A2 Antibody - Azide and BSA Free (NBP3-15749) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAN2A2 (NP_006113.2). VPPEPRPSFFSISPQDCQFALGGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAN2A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MAN2A2 Antibody - Azide and BSA Free

• alpha-mannosidase 2x
• alpha-mannosidase IIx
• EC 3.2.1.114
• Man IIx
• MAN2A2
• MANA2X
• mannosidase, alpha type II-X
• mannosidase, alpha, class 2A, member 2
• mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
• manosidase, alpha-, type II, isozyme X

Background

alpha 2 Mannosidase 1A catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundantendocannabinoid in tissues. Required for axonal growth during development and for retrograde synaptic signaling atmature synapses

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MAN2A2