MAN2A2 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit MAN2A2 Antibody - Azide and BSA Free (NBP3-15749) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAN2A2 (NP_006113.2). VPPEPRPSFFSISPQDCQFALGGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MAN2A2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for MAN2A2 Antibody - Azide and BSA Free
Background
alpha 2 Mannosidase 1A catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundantendocannabinoid in tissues. Required for axonal growth during development and for retrograde synaptic signaling atmature synapses
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for MAN2A2 Antibody (NBP3-15749) (0)
There are no publications for MAN2A2 Antibody (NBP3-15749).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAN2A2 Antibody (NBP3-15749) (0)
There are no reviews for MAN2A2 Antibody (NBP3-15749).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MAN2A2 Antibody (NBP3-15749) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAN2A2 Products
Research Areas for MAN2A2 Antibody (NBP3-15749)
Find related products by research area.
|
Blogs on MAN2A2