MAMLD1 Recombinant Protein Antigen

Images

 
There are currently no images for MAMLD1 Protein (NBP1-84530PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MAMLD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAMLD1.

Source: E.coli

Amino Acid Sequence: KRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPAAMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPNELDLE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAMLD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84530.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAMLD1 Recombinant Protein Antigen

  • chromosome X open reading frame 6
  • CXorf6Protein CG1
  • F18CG1mastermind-like domain-containing protein 1
  • HYSP2
  • mastermind-like domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2568
Species: Mu
Applications: WB, IHC
NBP2-14627
Species: Hu
Applications: IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-1414
Species: Hu
Applications: WB, PEP-ELISA
H00056899-P01
Species: Hu
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP1-84530PEP
Species: Hu
Applications: AC

Publications for MAMLD1 Protein (NBP1-84530PEP) (0)

There are no publications for MAMLD1 Protein (NBP1-84530PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAMLD1 Protein (NBP1-84530PEP) (0)

There are no reviews for MAMLD1 Protein (NBP1-84530PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MAMLD1 Protein (NBP1-84530PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAMLD1 Products

Bioinformatics Tool for MAMLD1 Protein (NBP1-84530PEP)

Discover related pathways, diseases and genes to MAMLD1 Protein (NBP1-84530PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAMLD1 Protein (NBP1-84530PEP)

Discover more about diseases related to MAMLD1 Protein (NBP1-84530PEP).
 

Pathways for MAMLD1 Protein (NBP1-84530PEP)

View related products by pathway.

Blogs on MAMLD1

There are no specific blogs for MAMLD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAMLD1 Antibody
NBP1-84530
MAMLD1 Antibody
NBP1-84530
MAMLD1 Antibody
NBP1-84530

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAMLD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAMLD1