MAMLD1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MAMLD1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAMLD1.
  
  

  Source: E. coli

  Amino Acid Sequence: KRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPAAMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPNELDLE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MAMLD1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84530.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAMLD1 Recombinant Protein Antigen

• chromosome X open reading frame 6
• CXorf6Protein CG1
• F18CG1mastermind-like domain-containing protein 1
• HYSP2
• mastermind-like domain containing 1

Background

MAMLD1, or Mastermind-like domain-containing protein 1, contains a 83 kDa, 106 kDa, and 80 kDa isoform, and is involved in transcription and acts as a co-activator for the HES3 promoter. Current research is being conducted on MAMLD1 and its relation to x-linked hypospadias type 2, myopathy, and spermatic cord torsion. The protein has no known interactions with any other proteins, but it is linked to the Notch-HLH transcription pathway, regulation of DNA-dependent transcription, and male gonad development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MAMLD1