LYZL4 Antibody

Images

 
Western Blot: LYZL4 Antibody [NBP2-85247] - WB Suggested Anti-LYZL4 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell

Product Details

Summary
Reactivity Hu, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYZL4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of LYZL4. Peptide sequence: FNPMAIYENTREGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEK The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Equine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
LYZL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYZL4 Antibody

  • LYC4lysozyme-like protein 4
  • lysozyme-4
  • Lysozyme-4,1810009N24Rik
  • lysozyme-like 4
  • MGC26768

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89136
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82810
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41184
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-85247
Species: Hu, Eq
Applications: WB

Publications for LYZL4 Antibody (NBP2-85247) (0)

There are no publications for LYZL4 Antibody (NBP2-85247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYZL4 Antibody (NBP2-85247) (0)

There are no reviews for LYZL4 Antibody (NBP2-85247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYZL4 Antibody (NBP2-85247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LYZL4 Products

Bioinformatics Tool for LYZL4 Antibody (NBP2-85247)

Discover related pathways, diseases and genes to LYZL4 Antibody (NBP2-85247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LYZL4 Antibody (NBP2-85247)

View related products by pathway.

PTMs for LYZL4 Antibody (NBP2-85247)

Learn more about PTMs related to LYZL4 Antibody (NBP2-85247).

Blogs on LYZL4

There are no specific blogs for LYZL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYZL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYZL4