![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short-term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, and Beta2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) and hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8-14 or (b) 54-60 (n = 8). (c and d) Representative images of western blots summarized in (a) and (b), respectively. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jnc.13718) licensed under a CC-BY licence.](http://images.novusbio.com/fullsize2/Ly-6H-Antibody-(3E10)-Western-Blot-H00004062-M01-img0007.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short-term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, and Beta2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) and hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8-14 or (b) 54-60 (n = 8). (c and d) Representative images of western blots summarized in (a) and (b), respectively. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jnc.13718) licensed under a CC-BY licence.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC, IHC-P, IP |
| Clone | 3E10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | LY6H (AAH28894, 26 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP |
| Localization | Cell membrane. Lipid-anchor, GPI-anchor. |
| Specificity | LY6H - lymphocyte antigen 6 complex, locus H |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LY6H |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. Use in ICC reported in scientific literature (PMID: 25716842). Use in immunoprecipitation reported in scientific literature (PMID: 25716842). Use in Immunohistochemistry reported in scientific literature (PMID: 25716842). |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunocytochemistry/Immunofluorescence: Peripherin Antibody [NB300-137] - Mixed neuron/glia cultures from newborn rat brain stained with NB300-137 antibody to peripherin (green) and chicken polyclonal antibody to phosphorylated NF-H (red channel). A class of large neurons, like the one at the top right of this image, contain peripherin, while the majority of neurons and their processes contain NF-H and not peripherin. The blue channel reveals the localization of DNA.](http://images.novusbio.com/images2/Peripherin-Antibody-Immunocytochemistry-Immunofluorescence-NB300-137-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Peripherin Antibody [NB300-137] - Analysis of the widely used rat pheochromocytoma PC12 cell line stained with rabbit polyclonal Periphren antibody, dilution 1:2000 (Green). Hoechst staining of nuclear DNA (Blue). Peripherin, one of the Class III family of intermediate filament subunit proteins, is a major component of the PC12 cell forming a perinuclear cap, with some filaments visible in the cytoplasm.](http://images.novusbio.com/images2/Peripherin-Antibody-Immunocytochemistry-Immunofluorescence-NB300-137-img0003.jpg)
![Western Blot: Peripherin Antibody [NB300-137] - Analysis of tissue and cell lysates using Peripherin antibody, dilution 1:10000 in green: [1] protein standard, [2] rat spinal cord, [3] mouse spinal cord, [4] pig spinal cord, [5] cow spinal cord, [6] SH-SY5Y cells and [7] PC12 cells. The major band at ~57kDa corresponds to the major peripherin protein isoform, while other bands presumably represent protein products of alternate transcripts of the peripherin gene.](http://images.novusbio.com/images2/Peripherin-Antibody-Western-Blot-NB300-137-img0004.jpg)
![Western Blot: Ly-6G6C Overexpression Lysate (Adult Normal) [NBP2-06220] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Ly-6G6C.](http://images.novusbio.com/images/Ly-6G6C-Overexpression-Lysate-(Adult-Normal)-Western-Blot-NBP2-06220-img0001.jpg)
![Western Blot: LYNX1 Overexpression Lysate (Adult Normal) [NBL1-12755] - Western Blot experiments. Left-Control; Right -Over-expression Lysate for LYNX1](http://images.novusbio.com/images/LYNX1-Overexpression-Lysate-(Adult-Normal)-Western-Blot-NBL1-12755-img0001.jpg)
![Western Blot: LYNX1 Overexpression Lysate (Adult Normal) [NBL1-12755] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for LYNX1.](http://images.novusbio.com/images/LYNX1-Overexpression-Lysate-(Adult-Normal)-Western-Blot-NBL1-12755-img0002.jpg)
![ELISA: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)](http://images.novusbio.com/images2/Nicotinic-Acetylcholine-R-alpha-4-CHRNA4-Antibody-(7B4H1)-ELISA-NBP2-61674-img0001.jpg)
![Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mAb against human CHRNA4 (AA: 29-242) recombinant protein. (Expected MW is 52.5 kDa)](http://images.novusbio.com/images2/Nicotinic-Acetylcholine-R-alpha-4-CHRNA4-Antibody-(7B4H1)-Western-Blot-NBP2-61674-img0002.jpg)
![Flow Cytometry: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mouse mAb against SH-SY5Y (1) cell lysate.](http://images.novusbio.com/images2/Nicotinic-Acetylcholine-R-alpha-4-CHRNA4-Antibody-(7B4H1)-Flow-Cytometry-NBP2-61674-img0004.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Meilin Wu |
WB | Mouse | 11/24/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for Ly-6H Antibody (H00004062-M01)Discover more about diseases related to Ly-6H Antibody (H00004062-M01).
|
Research Areas for Ly-6H Antibody (H00004062-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.](http://images.novusbio.com/fullsize2/Ly-6H-Antibody-(3E10)-Immunohistochemistry-Paraffin-H00004062-M01-img0005.jpg "Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.](http://images.novusbio.com/fullsize2/Ly-6H-Antibody-(3E10)-Western-Blot-H00004062-M01-img0003.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.](http://images.novusbio.com/fullsize2/Ly-6H-Antibody-(3E10)-Western-Blot-H00004062-M01-img0006.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.")
![Sandwich ELISA: GML Antibody (5F4) [H00002765-M01] - Detection limit for recombinant GST tagged GML is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/images2/GML-Antibody-(5F4)-Sandwich-ELISA-H00002765-M01-img0002.jpg)
![Western Blot: Ly-6D Antibody [NBP1-84029] - Analysis in human cell lines A-431 and Caco-2 using anti-LY6D antibody. Corresponding LY6D RNA-seq data are presented for the same cell lines. Loading control: anti-PARP1.](http://images.novusbio.com/images2/Ly-6D-Antibody-Western-Blot-NBP1-84029-img0009.jpg)
![Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP1-84029] - Staining of human cervix shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/images2/Ly-6D-Antibody-Immunohistochemistry-Paraffin-NBP1-84029-img0015.jpg)
![Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP1-84029] - Staining of human cervix, uterine, kidney, liver and skin using Anti-LY6D antibody NBP1-84029 (A) shows similar protein distribution across tissues to independent antibody NBP2-49416 (B).](http://images.novusbio.com/images2/Ly-6D-Antibody-Immunohistochemistry-Paraffin-NBP1-84029-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP1-52176] - Immunofluorescence analysis of paraformaldehyde fixed NIH3T3 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).](http://images.novusbio.com/images2/Ly-6E-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-52176-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP1-52176] - Immunofluorescence analysis of paraformaldehyde fixed L929 cells (Mouse fibroblast cell line), permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).](http://images.novusbio.com/images2/Ly-6E-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-52176-img0003.jpg)
![Flow Cytometry: Ly-6E Antibody [NBP1-52176] - Flow cytometric analysis of paraformaldehyde fixed NIH3T3 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/images2/Ly-6E-Antibody-Flow-Cytometry-NBP1-52176-img0004.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](http://images.novusbio.com/images2/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-(P3.6.2.8.1)-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
