![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.](http://images.novusbio.com/fullsize2/Ly-6H Antibody (3E10)-Western Blot-H00004062-M01-img0006.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC-P, IP |
| Clone | 3E10. |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | LY6H (AAH28894, 26 a.a. - 140 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP |
| Localization | Cell membrane. Lipid-anchor, GPI-anchor. |
| Specificity | LY6H - lymphocyte antigen 6 complex, locus H |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LY6H |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. IP usage reported in scientific literature (PMID: 25716842). |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Mouse | 11/24/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for Ly-6H Antibody (H00004062-M01)Discover more about diseases related to Ly-6H Antibody (H00004062-M01).
|
Research Areas for Ly-6H Antibody (H00004062-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.](http://images.novusbio.com/fullsize2/Ly-6H-Antibody-(3E10)-Immunohistochemistry-Paraffin-H00004062-M01-img0005.jpg "Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.](http://images.novusbio.com/fullsize2/Ly-6H-Antibody-(3E10)-Western-Blot-H00004062-M01-img0003.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.")
![Western Blot: PSCA Antibody [NBP2-33786] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize2/PSCA-Antibody-Western-Blot-NBP2-33786-img0006.jpg)
![Immunohistochemistry-Paraffin: PSCA Antibody [NBP2-33786] - Staining of human kidney shows strong cytoplasmic and membranous positivity in subset of renal tubules.](http://images.novusbio.com/fullsize2/PSCA-Antibody-Immunohistochemistry-Paraffin-NBP2-33786-img0001.jpg)
![Western Blot: PSCA Antibody [NBP2-33786] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Prostate tissue](http://images.novusbio.com/fullsize2/PSCA-Antibody-Western-Blot-NBP2-33786-img0005.jpg)
![Western Blot: Peripherin Antibody [NB300-137] - Analysis of whole rat spinal cord lysate stained with NB300-137, at dilution of 1:1,000. A prominent band running with an apparent SDS-PAGE molecular weight of ~57 kDa corresponds to Peripherin.](http://images.novusbio.com/fullsize2/Peripherin-Antibody-Western-Blot-NB300-137-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Peripherin Antibody [NB300-137] - Mixed neuron/glia cultures from newborn rat brain stained with NB300-137 antibody to peripherin (green) and chicken polyclonal antibody to phosphorylated NF-H (red channel). A class of large neurons, like the one at the top right of this image, contain peripherin, while the majority of neurons and their processes contain NF-H and not peripherin. The blue channel reveals the localization of DNA.](http://images.novusbio.com/fullsize2/Peripherin-Antibody-Immunocytochemistry-Immunofluorescence-NB300-137-img0001.jpg)
![Western Blot: Peripherin Antibody [NB300-137] Detection of the 57 kDa peripherin protein in whole rat brain stem homogenate using NB 300-137 (1:20,000). The faint 48 kDa band is a peripherin molecule.](http://images.novusbio.com/fullsize/p_4356adfdef9d7.jpg)
![Western Blot: Ly6K Antibody [NBP2-24405] - Analysis of Ly-6K in KK47 human bladder carcinoma cells using NBP2-24405. LY-6K siRNA, but not scrambled siRNA knocked down Ly-6K expression. A GAPDH antibody was used as a protein loading control. Data courtesy of Masuda et al.](http://images.novusbio.com/fullsize2/Ly6K-Antibody-Western-Blot-NBP2-24405-img0005.jpg)
![Western Blot: Ly6K Antibody [NBP2-24405] - Analysis of Ly-6K in T24 bladder carcinoma cells using NBP2-24405. A. Ly-6K expression was seen in Ly-6K transfected (T24/Ly-6K-TF) but not untransfected T24 cells. B. Ly-6K siRNA, but not scrambled siRNA knocked down Ly-6K expression in the](http://images.novusbio.com/fullsize2/Ly6K-Antibody-Western-Blot-NBP2-24405-img0004.jpg)
![Sandwich ELISA: GML Antibody (5F4) [H00002765-M01] - Detection limit for recombinant GST tagged GML is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/GML Antibody (5F4)-Sandwich ELISA-H00002765-M01-img0002.jpg)
![Immunohistochemistry-Frozen: Ly-6G6C Antibody (NIMP-R14) [NB600-1387] - Staining for Ly-6G/-6C FITC of frozen section of mouse spleen.](http://images.novusbio.com/fullsize2/Ly-6G6C-Antibody-(NIMP-R14)-Immunohistochemistry-Frozen-NB600-1387-img0005.jpg)
![Western Blot: LYNX1 Antibody [NBP1-80739] - Analysis in control (vector only transfected HEK293T lysate) and LYNX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/LYNX1 Antibody-Western Blot-NBP1-80739-img0005.jpg)
![Immunohistochemistry-Paraffin: LYNX1 Antibody [NBP1-80739] - Analysis in human cerebral cortex and skeletal muscle tissues using HPA023711 antibody. Corresponding LYNX1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/LYNX1-Antibody-Immunohistochemistry-Paraffin-NBP1-80739-img0010.jpg)
![Immunohistochemistry-Paraffin: LYNX1 Antibody [NBP1-80739] - Staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize2/LYNX1-Antibody-Immunohistochemistry-Paraffin-NBP1-80739-img0006.jpg)
![Western Blot: Ly-6D Antibody [NBP1-84029] - Analysis in human cell lines A-431 and Caco-2 using anti-LY6D antibody. Corresponding LY6D RNA-seq data are presented for the same cell lines. Loading control: anti-PARP1.](http://images.novusbio.com/fullsize2/Ly-6D-Antibody-Western-Blot-NBP1-84029-img0009.jpg)
![Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP1-84029] - Staining in human esophagus and small intestine tissues using anti-LY6D antibody. Corresponding LY6D RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Ly-6D-Antibody-Immunohistochemistry-Paraffin-NBP1-84029-img0008.jpg)
![Western Blot: Ly-6D Antibody [NBP1-84029] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize2/Ly-6D-Antibody-Western-Blot-NBP1-84029-img0005.jpg)
![Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mAb against HEK293 (1) and CHRNA4 (AA: 29-242)-hIgGFc transfected HEK293 (2) cell lysate.](http://images.novusbio.com/fullsize2/Nicotinic-Acetylcholine-R-alpha-4-CHRNA4-Antibody-(7B4H1)-Western-Blot-NBP2-61674-img0003.jpg)
![Flow Cytometry: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mouse mAb against SH-SY5Y (1) cell lysate.](http://images.novusbio.com/fullsize2/Nicotinic Acetylcholine R alpha 4-CHRNA4 Antibody (7B4H1)-Flow Cytometry-NBP2-61674-img0004.jpg)
![Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mAb against human CHRNA4 (AA: 29-242) recombinant protein. (Expected MW is 52.5 kDa)](http://images.novusbio.com/fullsize2/Nicotinic-Acetylcholine-R-alpha-4-CHRNA4-Antibody-(7B4H1)-Western-Blot-NBP2-61674-img0002.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Light Chain Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 647 conjugate of NBP1-43319. Mouse IgG1 isotype control was used as a negative control. Image from verified customer review.](http://images.novusbio.com/images2/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-(P3.6.2.8.1)-Flow-Cytometry-NBP1-43319-img0001.jpg "Flow Cytometry: Mouse IgG1 Kappa Light Chain Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 647 conjugate of NBP1-43319. Mouse IgG1 isotype control was used as a negative control. Image from verified customer review.")
