Ly-6H Antibody (3E10)

Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short-term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, and Beta2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) and hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8-14 or (b) 54-60 (n = 8). (c and d) Representative images of western blots summarized in (a) and (b), respectively. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jnc.13718) licensed under a CC-BY licence.

Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.

Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.

Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, IHC-P, IP
• Clone: 3E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Ly-6H Antibody (3E10) Summary

• Immunogen: LY6H (AAH28894, 26 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
• Localization: Cell membrane. Lipid-anchor, GPI-anchor.
• Specificity: LY6H - lymphocyte antigen 6 complex, locus H
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LY6H
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
• Application Notes: This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. Use in ICC reported in scientific literature (PMID: 25716842). Use in immunoprecipitation reported in scientific literature (PMID: 25716842). Use in Immunohistochemistry reported in scientific literature (PMID: 25716842).

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 23860910 and 25716842).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ly-6H Antibody (3E10)

• ly-6H
• lymphocyte antigen 6 complex, locus H
• lymphocyte antigen 6H
• NMLY6

Background

LY6H (Lymphocyte antigen 6 complex, Locus H) is a member of the LY6 antigens family of glycosylphosphatidylinositol-anchored cell surface glycoproteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ly-6H Antibody (H00004062-M01)(5)

Publications using H00004062-M01

• Grier BD, Belluscio L, Cheetham CE. Olfactory Sensory Activity Modulates Microglial-Neuronal Interactions during Dopaminergic Cell Loss in the Olfactory Bulb Front Cell Neurosci 2016 Jul 29 [PMID: 27471450] (WB, Rat)
• Arvaniti M, Jensen MM, Soni N et al. Functional interaction between Lypd6 and nicotinic acetylcholine receptors. J Neurochem 2016 Sep [PMID: 27344019] (WB)
• Kalinowska M, Castillo C, Francesconi A. Quantitative profiling of brain lipid raft proteome in a mouse model of fragile x syndrome. PLoS One. 2015 Apr 07 [PMID: 25849048]
• Puddifoot CA, Wu M, Sung RJ, Joiner WJ. Ly6h regulates trafficking of alpha7 nicotinic acetylcholine receptors and nicotine-induced potentiation of glutamatergic signaling J. Neurosci. 2015 Feb 25 [PMID: 25716842] (WB, IHC, IP, Human)
• Thomsen MS, Cinar B, Jensen MM et al. Expression of the Ly-6 family proteins Lynx1 and Ly6H in the rat brain is compartmentalized, cell-type specific, and developmentally regulated. Brain Struct Funct 2013 Jul 17 [PMID: 23860910] (WB, Rat)

Review for Ly-6H Antibody (H00004062-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Anonymous WB Mouse 11/24/2014

Summary

• Application: Western Blot
• Species: Mouse
• Special Applications: Hello, we have used your rat-Ly6h antibody and shown that is recognizes the mouse Ly6h protein and is specific for Ly6h when tested on several other mouse Ly6 proteins (See attached pdf). Since this antibody was previously only validated for rat Ly6h, we would like to submit this data to request the antibody purchase credit. The order information is included in the forwarded email below. Please let me know if there is anything further you require for us to receive the credit.
• File: View PDF

Bioinformatics

• Gene Symbol: LY6H
• Entrez:
  • 4062(Human)
• OMIM:
  • 603625(Human)
• Uniprot:
  • AAH28894(Human)