![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short-term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, and Beta2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) and hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8-14 or (b) 54-60 (n = 8). (c and d) Representative images of western blots summarized in (a) and (b), respectively. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jnc.13718) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Ly-6H-Antibody-3E10-Western-Blot-H00004062-M01-img0007.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short-term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, and Beta2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) and hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8-14 or (b) 54-60 (n = 8). (c and d) Representative images of western blots summarized in (a) and (b), respectively. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jnc.13718) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC, IP |
| Clone | 3E10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | LY6H (AAH28894, 26 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP |
| Localization | Cell membrane. Lipid-anchor, GPI-anchor. |
| Specificity | LY6H - lymphocyte antigen 6 complex, locus H |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LY6H |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. Use in ICC reported in scientific literature (PMID: 25716842). Use in immunoprecipitation reported in scientific literature (PMID: 25716842). Use in Immunohistochemistry reported in scientific literature (PMID: 25716842). |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 11/24/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Ly-6H Antibody (H00004062-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.](http://images.novusbio.com/fullsize/Ly-6H-Antibody-3E10-Immunohistochemistry-Paraffin-H00004062-M01-img0005.jpg "Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.](http://images.novusbio.com/fullsize/Ly-6H-Antibody-3E10-Western-Blot-H00004062-M01-img0003.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.](http://images.novusbio.com/fullsize/Ly-6H-Antibody-3E10-Western-Blot-H00004062-M01-img0006.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short‐term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, & beta 2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) & hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8–14 or (b) 54–60 (n = 8). (c & d) Representative images of western blots summarized in (a) & (b), respectively. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27344019), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004062-m01_mouse-monoclonal-ly-6h-antibody-3e10-310202415395950.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short‐term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, & beta 2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) & hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8–14 or (b) 54–60 (n = 8). (c & d) Representative images of western blots summarized in (a) & (b), respectively. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27344019), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short‐term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, & beta 2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) & hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8–14 or (b) 54–60 (n = 8). (c & d) Representative images of western blots summarized in (a) & (b), respectively. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27344019), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004062-m01_mouse-monoclonal-ly-6h-antibody-3e10-310202415371961.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short‐term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, & beta 2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) & hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8–14 or (b) 54–60 (n = 8). (c & d) Representative images of western blots summarized in (a) & (b), respectively. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27344019), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short‐term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, & beta 2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) & hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8–14 or (b) 54–60 (n = 8). (c & d) Representative images of western blots summarized in (a) & (b), respectively. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27344019), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004062-m01_mouse-monoclonal-ly-6h-antibody-3e10-310202415371984.jpg "Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Short‐term nicotine exposure does not alter Lypd6, Lynx1, or Ly6H levels in the brain. Lypd6, Lynx1, Ly6H, & beta 2 nAChR subunit protein levels were analyzed in (a) frontal cortex (FC) & hippocampal (HIP) tissue from rats administered nicotine (0.4 mg/kg s.c., twice daily) or vehicle (0.9% saline) for 7 days from day 8–14 or (b) 54–60 (n = 8). (c & d) Representative images of western blots summarized in (a) & (b), respectively. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27344019), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
