Ly-6H Antibody (1D1)

Images

 
There are currently no images for Ly-6H Antibody (H00004062-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ly-6H Antibody (1D1) Summary

Immunogen
LY6H (AAH28894, 26 a.a. - 140 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LY6H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ly-6H Antibody (1D1)

  • ly-6H
  • lymphocyte antigen 6 complex, locus H
  • lymphocyte antigen 6H
  • NMLY6

Background

LY6H (Lymphocyte antigen 6 complex, Locus H) is a member of the LY6 antigens family of glycosylphosphatidylinositol-anchored cell surface glycoproteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7636
Species: Hu
Applications: IHC
NB300-137
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24405
Species: Hu
Applications: WB, ELISA
H00002765-M01
Species: Hu
Applications: WB, ELISA
NB600-1387
Species: Hu, Mu
Applications: Flow, Func, IA, ICC/IF, IHC, IHC-Fr, IHC-P
NBL1-12755
Species: Hu
NBP1-84029
Species: Hu
Applications: WB, IHC, IHC-P
H00004061-D01P
Species: Hu
Applications: WB

Publications for Ly-6H Antibody (H00004062-M02) (0)

There are no publications for Ly-6H Antibody (H00004062-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6H Antibody (H00004062-M02) (0)

There are no reviews for Ly-6H Antibody (H00004062-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6H Antibody (H00004062-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ly-6H Products

Bioinformatics Tool for Ly-6H Antibody (H00004062-M02)

Discover related pathways, diseases and genes to Ly-6H Antibody (H00004062-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6H Antibody (H00004062-M02)

Discover more about diseases related to Ly-6H Antibody (H00004062-M02).

Research Areas for Ly-6H Antibody (H00004062-M02)

Find related products by research area.

Blogs on Ly-6H

There are no specific blogs for Ly-6H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ly-6H Antibody (1D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6H
Uniprot