LSM12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LSM12 Antibody [NBP2-14205] - Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Immunohistochemistry-Paraffin: LSM12 Antibody [NBP2-14205] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LSM12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHAD ILLINLQYVSEVEIINDRTETPPPLASLNVSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LSM12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LSM12 Protein (NBP2-14205PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LSM12 Antibody

  • FLJ30656
  • LSM12 homolog (S. cerevisiae)
  • MGC104211
  • PNAS-135
  • protein LSM12 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14594
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-30473
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14205
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for LSM12 Antibody (NBP2-14205) (0)

There are no publications for LSM12 Antibody (NBP2-14205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM12 Antibody (NBP2-14205) (0)

There are no reviews for LSM12 Antibody (NBP2-14205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LSM12 Antibody (NBP2-14205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSM12 Products

Bioinformatics Tool for LSM12 Antibody (NBP2-14205)

Discover related pathways, diseases and genes to LSM12 Antibody (NBP2-14205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LSM12 Antibody (NBP2-14205)

View related products by pathway.

Blogs on LSM12

There are no specific blogs for LSM12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LSM12