Recombinant Human LRIT3 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human LRIT3 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 422 - 496 of Human LRIT3 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: LRIT3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRIT3 GST (N-Term) Protein

• CSNB1F
• fibronectin type III, immunoglobulin and leucine rich repeat domains 4
• FIGLER4
• FLJ44691
• Gm421
• leucine-rich repeat, immunoglobulin-like and transmembrane domains 3
• leucine-rich repeat, immunoglobulin-like domain and transmembranedomain-containing protein 3
• LRIT3
• MGC120618

Background

FLJ44691 - FLJ44691 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRIT3