LPAR6/P2RY5 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LPAR6. Source: E. coli
Amino Acid Sequence: NWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
LPAR6 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14197. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for LPAR6/P2RY5 Recombinant Protein Antigen
Background
The purinergic receptor P2Y5 (LPAR6/P2RY5) is a member of the Purinergic Receptor subfamily. Membrane-bound P2 receptors mediate the actions of extracellular nucleotides in cell-to-cell signaling. P2Y5 expression has been documented in dendritic cells, monocyte-derived dendritic cells, and macrophages. ESTs have been isolated from embryo, heart/melanocyte/uterus, kidney, liver/spleen, lung, pancreas, placenta, uterus, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Bt, Ha, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: AC
Publications for LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP) (0)
There are no publications for LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP) (0)
There are no reviews for LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP) (0)
Additional LPAR6/P2RY5 Products
Research Areas for LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP)
Find related products by research area.
|
Blogs on LPAR6/P2RY5