![Western Blot: C2orf43 Antibody [H00060526-B01P] - Analysis of C2orf43 expression in transfected 293T cell line by C2orf43 polyclonal antibody. Lane 1: FLJ21820 transfected lysate(35.75 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/C2orf43-Antibody-Western-Blot-H00060526-B01P-img0002.jpg "Western Blot: C2orf43 Antibody [H00060526-B01P] - Analysis of C2orf43 expression in transfected 293T cell line by C2orf43 polyclonal antibody. Lane 1: FLJ21820 transfected lysate(35.75 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse LDAH Antibody - Azide and BSA Free (H00060526-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | C2orf43 (NP_068744.1, 1 a.a. - 325 a.a.) full-length human protein. MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM |
| Specificity | C2orf43 - chromosome 2 open reading frame 43, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | LDAH |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against transfected lysate for western blot and recombinant protein with GST tag for ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LDAH |
| Entrez |
|
| Uniprot |
|
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")