KLHL26 Antibody

Images

 
Western Blot: KLHL26 Antibody [NBP2-34187] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: KLHL26 Antibody [NBP2-34187] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL26 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LAVEYYVPETDQWTSVSPMRAGQSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESF
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL26
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KLHL26 Protein (NBP2-34187PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHL26 Antibody

  • Kelch-Like 26
  • Kelch-Like Family Member 26
  • Kelch-Like Protein 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-67338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KLHL26 Antibody (NBP2-34187) (0)

There are no publications for KLHL26 Antibody (NBP2-34187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL26 Antibody (NBP2-34187) (0)

There are no reviews for KLHL26 Antibody (NBP2-34187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL26 Antibody (NBP2-34187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLHL26 Products

Bioinformatics Tool for KLHL26 Antibody (NBP2-34187)

Discover related pathways, diseases and genes to KLHL26 Antibody (NBP2-34187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL26 Antibody (NBP2-34187)

Discover more about diseases related to KLHL26 Antibody (NBP2-34187).

Blogs on KLHL26

There are no specific blogs for KLHL26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL26
Uniprot