KLHDC8B Antibody


Western Blot: KLHDC8B Antibody [NBP1-70591] - Titration: 0.2-1 ug/ml, Positive Control: Human Stomach.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

KLHDC8B Antibody Summary

Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the N terminal of KLHDC8B. Peptide sequence MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KLHDC8B and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHDC8B Antibody

  • FLJ11302
  • FP17659
  • kelch domain containing 8B


KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready

Publications for KLHDC8B Antibody (NBP1-70591) (0)

There are no publications for KLHDC8B Antibody (NBP1-70591).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHDC8B Antibody (NBP1-70591) (0)

There are no reviews for KLHDC8B Antibody (NBP1-70591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHDC8B Antibody (NBP1-70591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KLHDC8B Products

Bioinformatics Tool for KLHDC8B Antibody (NBP1-70591)

Discover related pathways, diseases and genes to KLHDC8B Antibody (NBP1-70591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHDC8B Antibody (NBP1-70591)

Discover more about diseases related to KLHDC8B Antibody (NBP1-70591).

Pathways for KLHDC8B Antibody (NBP1-70591)

View related products by pathway.

Blogs on KLHDC8B

There are no specific blogs for KLHDC8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KLHDC8B Antibody and receive a gift card or discount.


Gene Symbol KLHDC8B