KIF26B Recombinant Protein Antigen

Images

 
There are currently no images for KIF26B Protein (NBP1-90445PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF26B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF26B.

Source: E.coli

Amino Acid Sequence: TSFSGILQTSPPPAPPCLLRAVNKVKDTPGLGKVKVMLRICSTLARDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRGNQVPPKMF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF26B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90445.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF26B Recombinant Protein Antigen

  • kinesin family member 26B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59845
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47657
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010472-D01P
Species: Hu
Applications: WB, ELISA
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-27197
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
46530002
Species: Hu
Applications: ELISA
H00011127-B01P-50ug
Species: Hu, Rt
Applications: WB
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81512
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81634
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051168-M01
Species: Hu
Applications: WB, ELISA
NBP2-47579
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2134
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P, IP
NBP2-46044
Species: Hu
Applications: WB, IHC
NBP1-94086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90445PEP
Species: Hu
Applications: AC

Publications for KIF26B Protein (NBP1-90445PEP) (0)

There are no publications for KIF26B Protein (NBP1-90445PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF26B Protein (NBP1-90445PEP) (0)

There are no reviews for KIF26B Protein (NBP1-90445PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for KIF26B Protein (NBP1-90445PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP1-90445PEP

Bioinformatics Tool for KIF26B Protein (NBP1-90445PEP)

Discover related pathways, diseases and genes to KIF26B Protein (NBP1-90445PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF26B Protein (NBP1-90445PEP)

Discover more about diseases related to KIF26B Protein (NBP1-90445PEP).
 

Pathways for KIF26B Protein (NBP1-90445PEP)

View related products by pathway.

PTMs for KIF26B Protein (NBP1-90445PEP)

Learn more about PTMs related to KIF26B Protein (NBP1-90445PEP).

Blogs on KIF26B

There are no specific blogs for KIF26B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
KIF26B Antibody
NBP1-90443

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF26B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF26B