Kelch-Like Family Member 21 Antibody


Immunohistochemistry-Paraffin: Kelch-Like Family Member 21 Antibody [NBP2-30654] - Staining of human colon shows strong cytoplasmic positivity in a granular pattern in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Kelch-Like Family Member 21 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MNQVHVGGSLAVLGGKLYVSGGYDNTFELSDVVEAYDPETRAWSVVGRLPEPTFWHGSVSIFRQFMPQTFSGGRGFELD
Specificity of human Kelch-Like Family Member 21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kelch-Like Family Member 21 Protein (NBP2-30654PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kelch-Like Family Member 21 Antibody

  • kelch-like 21 (Drosophila)
  • Kelch-Like Protein 21
  • KIAA0469
  • KLHL21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Kelch-Like Family Member 21 Antibody (NBP2-30654) (0)

There are no publications for Kelch-Like Family Member 21 Antibody (NBP2-30654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kelch-Like Family Member 21 Antibody (NBP2-30654) (0)

There are no reviews for Kelch-Like Family Member 21 Antibody (NBP2-30654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kelch-Like Family Member 21 Antibody (NBP2-30654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kelch-Like Family Member 21 Products

Bioinformatics Tool for Kelch-Like Family Member 21 Antibody (NBP2-30654)

Discover related pathways, diseases and genes to Kelch-Like Family Member 21 Antibody (NBP2-30654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Kelch-Like Family Member 21 Antibody (NBP2-30654)

View related products by pathway.

PTMs for Kelch-Like Family Member 21 Antibody (NBP2-30654)

Learn more about PTMs related to Kelch-Like Family Member 21 Antibody (NBP2-30654).

Blogs on Kelch-Like Family Member 21

There are no specific blogs for Kelch-Like Family Member 21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kelch-Like Family Member 21 Antibody and receive a gift card or discount.


Gene Symbol KLHL21