Katanin p60 Antibody


Immunocytochemistry/ Immunofluorescence: Katanin p60 Antibody [NBP1-89491] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & microtubule organizing center.
Immunohistochemistry-Paraffin: Katanin p60 Antibody [NBP1-89491] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Katanin p60 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDD
Specificity of human Katanin p60 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Katanin p60 Protein (NBP1-89491PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Katanin p60 Antibody

  • EC
  • katanin p60 (ATPase containing) subunit A 1
  • katanin p60 (ATPase-containing) subunit A 1
  • katanin p60 ATPase-containing subunit A1
  • Katanin p60 subunit A1
  • Katanin p60
  • KATNA1
  • p60 katanin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Katanin p60 Antibody (NBP1-89491) (0)

There are no publications for Katanin p60 Antibody (NBP1-89491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Katanin p60 Antibody (NBP1-89491) (0)

There are no reviews for Katanin p60 Antibody (NBP1-89491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Katanin p60 Antibody (NBP1-89491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Katanin p60 Products

Bioinformatics Tool for Katanin p60 Antibody (NBP1-89491)

Discover related pathways, diseases and genes to Katanin p60 Antibody (NBP1-89491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Katanin p60

There are no specific blogs for Katanin p60, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Katanin p60 Antibody and receive a gift card or discount.


Gene Symbol KATNA1