IQCG Antibody

Images

 
Western Blot: IQCG Antibody [NBP2-62622] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: IQCG Antibody [NBP2-62622] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: IQCG Antibody [NBP2-62622] - Immunohistochemistry analysis in human fallopian tube and duodenum tissues using Anti-IQCG antibody. Corresponding IQCG RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: IQCG Antibody [NBP2-62622] - Staining of human fallopian tube shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IQCG Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IQCG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IQCG Recombinant Protein Antigen (NBP2-62622PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for IQCG Antibody

  • DKFZp434B227
  • FLJ11667
  • FLJ23571
  • FLJ37775
  • IQ domain-containing protein G
  • IQ motif containing G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93325
Species: Hu
Applications: WB, IP
NBP1-82454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB414
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75545
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-62622
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IQCG Antibody (NBP2-62622) (0)

There are no publications for IQCG Antibody (NBP2-62622).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IQCG Antibody (NBP2-62622) (0)

There are no reviews for IQCG Antibody (NBP2-62622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IQCG Antibody (NBP2-62622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-62622

Bioinformatics Tool for IQCG Antibody (NBP2-62622)

Discover related pathways, diseases and genes to IQCG Antibody (NBP2-62622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IQCG Antibody (NBP2-62622)

Discover more about diseases related to IQCG Antibody (NBP2-62622).
 

Pathways for IQCG Antibody (NBP2-62622)

View related products by pathway.

Blogs on IQCG

There are no specific blogs for IQCG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IQCG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IQCG