Recombinant Human IQCB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IQCB1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 366-464 of Human IQCB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LEERAQQHREALIAQISTNVEQLMKAPSLKEAEGKEPELFLSRSRPVAAKAKQAHLTTLKHIQAPWWKKLGEESGDEIDVPKDELSIELENLFIGGTKP

Protein/Peptide Type
Partial Recombinant Protein
Gene
IQCB1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IQCB1 Protein

  • IQ calmodulin-binding motif containing 1
  • IQ motif containing B1
  • KIAA0036nephrocystin 5
  • Nephrocystin-5
  • NPHP5IQ calmodulin-binding motif-containing protein 1
  • p53 and DNA damage-regulated IQ motif protein
  • PIQ
  • SLSN5

Background

IQCB1 - IQ motif containing B1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
H00027130-P02
Species: Hu
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-39059
Species: Hu
Applications: IHC, IHC-P
H00004867-D01P
Species: Hu, Mu
Applications: WB
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46476
Species: Hu
Applications: WB, IHC
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for IQCB1 Partial Recombinant Protein (H00009657-Q01) (0)

There are no publications for IQCB1 Partial Recombinant Protein (H00009657-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IQCB1 Partial Recombinant Protein (H00009657-Q01) (0)

There are no reviews for IQCB1 Partial Recombinant Protein (H00009657-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IQCB1 Partial Recombinant Protein (H00009657-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IQCB1 Products

Bioinformatics Tool for IQCB1 Partial Recombinant Protein (H00009657-Q01)

Discover related pathways, diseases and genes to IQCB1 Partial Recombinant Protein (H00009657-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IQCB1 Partial Recombinant Protein (H00009657-Q01)

Discover more about diseases related to IQCB1 Partial Recombinant Protein (H00009657-Q01).
 

Pathways for IQCB1 Partial Recombinant Protein (H00009657-Q01)

View related products by pathway.

PTMs for IQCB1 Partial Recombinant Protein (H00009657-Q01)

Learn more about PTMs related to IQCB1 Partial Recombinant Protein (H00009657-Q01).

Blogs on IQCB1

There are no specific blogs for IQCB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IQCB1 Antibody
NBP2-14126

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IQCB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IQCB1