![Western Blot: INTS11 Antibody [NBP3-03680] - Analysis of extracts of various cell lines, using INTS11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.](http://images.novusbio.com/fullsize/INTS11-Antibody-Western-Blot-NBP3-03680-img0002.jpg "Western Blot: INTS11 Antibody [NBP3-03680] - Analysis of extracts of various cell lines, using INTS11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit INTS11 Antibody - BSA Free (NBP3-03680) is a polyclonal antibody validated for use in WB, ELISA, ICC/IF and IP. Anti-INTS11 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 331-600 of human INTS11 (NP_060341.2). GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | INTS11 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 68 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP3-03680 | Applications | Species |
|---|---|---|
| Cihlarova Z, Kubovciak J, Sobol M et al. BRAT1 links Integrator and defective RNA processing with neurodegeneration Nature communications Aug 26 2022 [PMID: 36028512] (ICC/IF, Human) Details: Supplementary fig. 2E; Dilutions: 1:500 |
ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | INTS11 |
![Immunoprecipitation: INTS11 Antibody [NBP3-03680] - Analysis of 300ug extracts of HeLa cells using 3ug CPSF3L antibody. Western blot was performed from the immunoprecipitate using CPSF3L antibody at a dilition of 1:500.](http://images.novusbio.com/fullsize/INTS11-Antibody-Immunoprecipitation-NBP3-03680-img0003.jpg "Immunoprecipitation: INTS11 Antibody [NBP3-03680] - Analysis of 300ug extracts of HeLa cells using 3ug CPSF3L antibody. Western blot was performed from the immunoprecipitate using CPSF3L antibody at a dilition of 1:500.")
![Immunocytochemistry/ Immunofluorescence: INTS11 Antibody - BSA Free [NBP3-03680] - Immunofluorescence analysis of HeLa cells using INTS11 Rabbit pAb (A6566). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03680_rabbit-polyclonal-ints11-antibody-52202519302992.jpg "Immunocytochemistry/ Immunofluorescence: INTS11 Antibody - BSA Free [NBP3-03680] - Immunofluorescence analysis of HeLa cells using INTS11 Rabbit pAb (A6566). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")