INTS11 Antibody

Images

 
Western Blot: INTS11 Antibody [NBP1-85475] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: INTS11 Antibody [NBP1-85475] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: INTS11 Antibody [NBP1-85475] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INTS11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPSF3L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
INTS11 Protein (NBP1-85475PEP)
Publications
Read Publication using NBP1-85475.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INTS11 Antibody

  • cleavage and polyadenylation specific factor 3-like
  • Cleavage and polyadenylation-specific factor 3-like protein
  • CPSF3-like protein
  • EC 3.1.27
  • EC 3.1.27.-
  • FLJ20542
  • INT11
  • integrator complex subunit 11
  • INTS11FLJ13294
  • Protein related to CPSF subunits of 68 kDa
  • RC68
  • RC-68CPSF73L
  • related to CPSF subunits 68 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051692-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-79823
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP2-57534
Species: Hu
Applications: WB, ICC/IF
NBP1-85475
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for INTS11 Antibody (NBP1-85475)(1)

Reviews for INTS11 Antibody (NBP1-85475) (0)

There are no reviews for INTS11 Antibody (NBP1-85475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for INTS11 Antibody (NBP1-85475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INTS11 Products

Bioinformatics Tool for INTS11 Antibody (NBP1-85475)

Discover related pathways, diseases and genes to INTS11 Antibody (NBP1-85475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for INTS11 Antibody (NBP1-85475)

View related products by pathway.

PTMs for INTS11 Antibody (NBP1-85475)

Learn more about PTMs related to INTS11 Antibody (NBP1-85475).

Blogs on INTS11

There are no specific blogs for INTS11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INTS11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPSF3L