HSPC111 Antibody - BSA Free

Images

 
Independent Antibodies: Western Blot: HSPC111 Antibody [NBP2-58774] - Analysis using Anti-NOP16 antibody NBP2-58774 (A) shows similar pattern to independent antibody NBP1-89659 (B).
Immunocytochemistry/ Immunofluorescence: HSPC111 Antibody [NBP2-58774] - Staining of human cell line MCF7 shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

View Available Formulations
Catalog# & Formulation Size Price

HSPC111 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit HSPC111 Antibody - BSA Free (NBP2-58774) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOP16
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSPC111 Recombinant Protein Antigen (NBP2-58774PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HSPC111 Antibody - BSA Free

  • HBV pre-S2 trans-regulated protein 3
  • HSPC111HSPC185
  • LOC51491
  • NOP15
  • NOP16 nucleolar protein homolog (yeast)
  • nucleolar protein 16 homolog (yeast)
  • nucleolar protein 16 homolog
  • nucleolar protein 16

Background

NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB

Publications for HSPC111 Antibody (NBP2-58774) (0)

There are no publications for HSPC111 Antibody (NBP2-58774).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPC111 Antibody (NBP2-58774) (0)

There are no reviews for HSPC111 Antibody (NBP2-58774). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSPC111 Antibody (NBP2-58774) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSPC111 Products

Research Areas for HSPC111 Antibody (NBP2-58774)

Find related products by research area.

Blogs on HSPC111

There are no specific blogs for HSPC111, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPC111 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NOP16