HSPC111 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HSPC111 Antibody [NBP1-89659] - Staining of human cell line A-431 shows localization to nucleus, nucleoli & vesicles. Antibody staining is shown in green.

Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.

Staining of human cerebral cortex shows strong positivity in nucleoli in neurons.

Staining of human colon shows strong positivity in nucleoli in glandular cells.

Staining of human kidney shows strong positivity in nucleoli in cells in tubules.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: HSPC111 Antibody [NBP1-89659] - Analysis using Anti-NOP16 antibody NBP1-89659 (A) shows similar pattern to independent antibody NBP2-58774 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSPC111 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSPC111 Antibody - BSA Free (NBP1-89659) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOP16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HSPC111 Protein (NBP1-89659PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HSPC111 Antibody - BSA Free

• HBV pre-S2 trans-regulated protein 3
• HSPC111HSPC185
• LOC51491
• NOP15
• NOP16 nucleolar protein homolog (yeast)
• nucleolar protein 16 homolog (yeast)
• nucleolar protein 16 homolog
• nucleolar protein 16

Background

NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOP16