HSPC111 Antibody

Images

 
Western Blot: HSPC111 Antibody [NBP1-89659] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HSPC111 Antibody [NBP1-89659] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & vesicles.
Immunohistochemistry-Paraffin: HSPC111 Antibody [NBP1-89659] - Staining of human cerebellum shows strong nucleolar positivity in purkinje cells.
Western Blot: HSPC111 Antibody [NBP1-89659] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSPC111 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOP16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSPC111 Protein (NBP1-89659PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSPC111 Antibody

  • HBV pre-S2 trans-regulated protein 3
  • HSPC111HSPC185
  • LOC51491
  • NOP15
  • NOP16 nucleolar protein homolog (yeast)
  • nucleolar protein 16 homolog (yeast)
  • nucleolar protein 16 homolog
  • nucleolar protein 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for HSPC111 Antibody (NBP1-89659) (0)

There are no publications for HSPC111 Antibody (NBP1-89659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPC111 Antibody (NBP1-89659) (0)

There are no reviews for HSPC111 Antibody (NBP1-89659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSPC111 Antibody (NBP1-89659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSPC111 Products

Bioinformatics Tool for HSPC111 Antibody (NBP1-89659)

Discover related pathways, diseases and genes to HSPC111 Antibody (NBP1-89659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPC111 Antibody (NBP1-89659)

Discover more about diseases related to HSPC111 Antibody (NBP1-89659).
 

Pathways for HSPC111 Antibody (NBP1-89659)

View related products by pathway.

Research Areas for HSPC111 Antibody (NBP1-89659)

Find related products by research area.

Blogs on HSPC111

There are no specific blogs for HSPC111, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPC111 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOP16