HOXA9 Antibody


Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HOXA9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD
Specificity of human HOXA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 27832801).
Control Peptide
HOXA9 Protein (NBP2-32356PEP)
Read Publications using
NBP2-32356 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • WB
    2 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27832801).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HOXA9 Antibody

  • ABD-B
  • homeo box A9
  • homeobox A9
  • Homeobox protein Hox-1G
  • homeobox protein HOXA9
  • homeobox protein Hox-A9
  • homeodomain protein HOXA9
  • HOX1
  • HOX1.7
  • HOX1GMGC1934


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for HOXA9 Antibody (NBP2-32356)(4)

Reviews for HOXA9 Antibody (NBP2-32356) (0)

There are no reviews for HOXA9 Antibody (NBP2-32356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXA9 Antibody (NBP2-32356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional HOXA9 Products

Array NBP2-32356

Bioinformatics Tool for HOXA9 Antibody (NBP2-32356)

Discover related pathways, diseases and genes to HOXA9 Antibody (NBP2-32356). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA9 Antibody (NBP2-32356)

Discover more about diseases related to HOXA9 Antibody (NBP2-32356).

Pathways for HOXA9 Antibody (NBP2-32356)

View related products by pathway.

PTMs for HOXA9 Antibody (NBP2-32356)

Learn more about PTMs related to HOXA9 Antibody (NBP2-32356).

Research Areas for HOXA9 Antibody (NBP2-32356)

Find related products by research area.

Blogs on HOXA9

There are no specific blogs for HOXA9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXA9 Antibody and receive a gift card or discount.


Gene Symbol HOXA9