Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD
Specificity
Specificity of human HOXA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 27832801).
Rat reactivity reported in scientific literature (PMID: 27832801).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for HOXA9 Antibody
ABD-B
homeo box A9
homeobox A9
Homeobox protein Hox-1G
homeobox protein HOXA9
homeobox protein Hox-A9
homeodomain protein HOXA9
HOX1
HOX1.7
HOX1GMGC1934
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for HOXA9 Antibody (NBP2-32356)
Discover related pathways, diseases and genes to HOXA9 Antibody (NBP2-32356). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HOXA9 Antibody (NBP2-32356)
Discover more about diseases related to HOXA9 Antibody (NBP2-32356).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HOXA9 Antibody and receive a gift card or discount.
PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation
Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally.
![Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize2/HOXA9-Antibody-Western-Blot-NBP2-32356-img0016.jpg "Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.")
![Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/HOXA9-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32356-img0010.jpg "Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize2/HOXA9-Antibody-Immunohistochemistry-Paraffin-NBP2-32356-img0015.jpg "Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.](http://images.novusbio.com/fullsize2/HOXA9-Antibody-Immunohistochemistry-Paraffin-NBP2-32356-img0012.jpg "Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.")
![Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize2/HOXA9-Antibody-Immunohistochemistry-Paraffin-NBP2-32356-img0013.jpg "Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/HOXA9-Antibody-Immunohistochemistry-Paraffin-NBP2-32356-img0014.jpg "Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![Western Blot: MEIS1 Antibody [NBP2-24597] - Analysis of MEIS1 in mouse embryo brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24597 at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/MEIS1-Antibody-Western-Blot-NBP2-24597-img0002.jpg)
![Immunohistochemistry-Paraffin: MEIS1 Antibody [NBP2-24597] - Analysis of MEIS1 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.](http://images.novusbio.com/images2/MEIS1-Antibody-Immunohistochemistry-Paraffin-NBP2-24597-img0001.jpg)
![Western Blot: HOXA7 Antibody (2F2) [H00003204-M01] - Analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.Lane 1: HOXA7 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/HOXA7-Antibody-(2F2)-Western-Blot-H00003204-M01-img0004.jpg)
![Sandwich ELISA: HOXA7 Antibody (2F2) [H00003204-M01] - Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/images2/HOXA7-Antibody-(2F2)-Sandwich-ELISA-H00003204-M01-img0003.jpg)
![Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of various cell lines, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit](http://images.novusbio.com/images2/HOXA10-Antibody-Western-Blot-NBP3-04877-img0001.jpg)
![Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of Mouse kidney, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit](http://images.novusbio.com/images2/HOXA10 Antibody-Western Blot-NBP3-04877-img0002.jpg)
![Western Blot: NUP98 Antibody [NB100-93325] - Detection of Human NUP96 on HeLa whole cell lysate using NB100-93325. NUP96 was also immunoprecipitated by rabbit anti-NUP96 antibody NB100-93326.](http://images.novusbio.com/images2/NUP98-Antibody-Western-Blot-NB100-93325-img0002.jpg)
![Western Blot: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - WB analysis of lysates from (A) Human Embryonic Kidney 293 / HEK293 and (B) Human Embryonic carcinoma NCCIT cell lines using Flt-3/Flk-2/CD135 antibody (clone 7E8.2C8) at 2ug/ml concentration. The antibody detected single specific bands in both samples at the expected molecular weight position.](http://images.novusbio.com/images2/Flt-3-Flk-2-CD135-Antibody-(7E8.2C8)-Western-Blot-NBP2-42210-img0001.jpg)
![Immunohistochemistry-Paraffin: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver cancer using Flt-3/Flk-2/CD135 antibody (clone 7E2.2C8) at 15 ug/ml concentration. The antibody generated specific cytoplasmic immunostaining of FLT3 in the cancerous cells while the tumor stroma was largely negative for the staining.](http://images.novusbio.com/images2/Flt-3-Flk-2-CD135-Antibody-(7E8.2C8)-Immunohistochemistry-Paraffin-NBP2-42210-img0003.jpg)
![Flow Cytometry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - HEK293 cells were stained (surface) with Flt-3/Flk-2/CD135 antibody (clone: 7E8.2C8; red) or isotype control (mouse IgG2 lambda; blue) and positive staining observed using PE conjugated mouse anti-IgG(H+L) secondary antibody. Live cells (PPI negative) were gated for analysis](http://images.novusbio.com/images2/Flt-3-Flk-2-CD135-Antibody-(7E8.2C8)-Flow-Cytometry-NBP2-42210-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/images2/CD34 Antibody (MEC 14.7)-Immunocytochemistry-Immunofluorescence-NB600-1071-img0003.jpg)
![Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.](http://images.novusbio.com/images2/CD34-Antibody-(MEC-14.7)-Immunohistochemistry-Paraffin-NB600-1071-img0014.jpg)
![Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).](http://images.novusbio.com/images2/CD34-Antibody-(MEC-14.7)-Flow-Cytometry-NB600-1071-img0015.jpg)
![Western Blot: HOXA13 Antibody [NBP3-04717] - Analysis of extracts of various cell lines, using HOxA13 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit](http://images.novusbio.com/images2/HOXA13 Antibody-Western Blot-NBP3-04717-img0001.jpg)
![Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/images2/SUB1-Antibody-Western-Blot-NBP1-82454-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/images2/SUB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82454-img0011.jpg)
![Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://images.novusbio.com/images2/SUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-82454-img0015.jpg)
![Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.](http://images.novusbio.com/images2/PBX1-Antibody-(4A2)-Western-Blot-H00005087-M01-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/PBX1-Antibody-(4A2)-Immunocytochemistry-Immunofluorescence-H00005087-M01-img0006.jpg)
![Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/PBX1-Antibody-(4A2)-Immunohistochemistry-Paraffin-H00005087-M01-img0008.jpg)
![Western Blot: MRPL28 Antibody [NBP1-82805] - Analysis using Anti-MRPL28 antibody NBP1-82805 (A) shows similar pattern to independent antibody NBP2-38760 (B).](http://images.novusbio.com/images2/MRPL28 Antibody-Western Blot-NBP1-82805-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: MRPL28 Antibody [NBP1-82805] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/images2/MRPL28-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82805-img0006.jpg)
![Immunohistochemistry-Paraffin: MRPL28 Antibody [NBP1-82805] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/MRPL28-Antibody-Immunohistochemistry-Paraffin-NBP1-82805-img0002.jpg)
![Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of NXT1 expression in transfected 293T cell line by NXT1 monoclonal antibody (M08), clone 4F11. Lane 1: NXT1 transfected lysatE (15.51 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/NXT1 Antibody (4F11)-Western Blot-H00029107-M08-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of monoclonal antibody to NXT1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/NXT1-Antibody-(4F11)-Immunocytochemistry-Immunofluorescence-H00029107-M08-img0004.jpg)
![Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi or non-transfected control. Blot probed with H00029107-M08. GAPDH (36.1 kDa) used as loading control.](http://images.novusbio.com/images2/NXT1-Antibody-(4F11)-Western-Blot-H00029107-M08-img0002.jpg)
![Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0012.jpg)
![Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Immunohistochemistry-Paraffin-NBP1-30141-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Immunocytochemistry-Immunofluorescence-NBP1-30141-img0011.jpg)
![Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.](http://images.novusbio.com/images2/p16INK4a-CDKN2A-Antibody-Western-Blot-NB200-106-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0004.jpg)
![Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0006.jpg)
![Western Blot: HOXA5 Antibody [NBP2-42520] - Staining of Pig Kidney lysate with antibody at 1 ug/mL (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/images2/HOXA5-Antibody-Western-Blot-NBP2-42520-img0002.jpg)
![Immunohistochemistry-Paraffin: HOXA5 Antibody [NBP2-42520] - Staining of paraffin embedded Human Prostate. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/HOXA5-Antibody-Immunohistochemistry-Paraffin-NBP2-42520-img0003.jpg)
![Western Blot: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in K562 cell lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/HOXB4-Antibody-Western-Blot-NBP2-24561-img0003.jpg)
![Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.](http://images.novusbio.com/images2/HOXB4 Antibody-Immunohistochemistry-Paraffin-NBP2-24561-img0001.jpg)
![Western Blot: c-Myb Antibody [NBP1-80306] - WB Suggested Anti-MYB Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate](http://images.novusbio.com/images2/c-Myb Antibody-Western Blot-NBP1-80306-img0005.jpg)
![Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://images.novusbio.com/images2/c-Myb-Antibody-Immunohistochemistry-Paraffin-NBP1-80306-img0003.jpg)
![Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.](http://images.novusbio.com/images2/c-Myb-Antibody-Western-Blot-NBP1-80306-img0004.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")