![Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.](http://images.novusbio.com/fullsize2/HOXA9 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32356-img0010.jpg "Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD |
| Specificity | Specificity of human, rat HOXA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HOXA9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.Use in Western blot reported in scientific literature (PMID 27832801). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for HOXA9 Antibody (NBP2-32356)Discover more about diseases related to HOXA9 Antibody (NBP2-32356).
| Pathways for HOXA9 Antibody (NBP2-32356)View related products by pathway.
|
PTMs for HOXA9 Antibody (NBP2-32356)Learn more about PTMs related to HOXA9 Antibody (NBP2-32356).
| Research Areas for HOXA9 Antibody (NBP2-32356)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HOXA9 |
![Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells, glial cells were strongly stained..](http://images.novusbio.com/fullsize2/HOXA9-Antibody-Immunohistochemistry-Paraffin-NBP2-32356-img0009.jpg "Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells, glial cells were strongly stained..")
![Western Blot: MEIS1 Antibody [NBP2-24597] - Analysis of MEIS1 in mouse embryo brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24597 at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/fullsize2/MEIS1-Antibody-Western-Blot-NBP2-24597-img0002.jpg)
![Immunohistochemistry-Paraffin: MEIS1 Antibody [NBP2-24597] - Analysis of MEIS1 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.](http://images.novusbio.com/fullsize2/MEIS1-Antibody-Immunohistochemistry-Paraffin-NBP2-24597-img0001.jpg)
![Western Blot: KMT2A/MLL Antibody [NB600-248] - Samples: Nuclear extract (50 and 15 ug) from HeLa, 293T, and Jurkat cells. Antibody: Affinity purified rabbit anti-MLL1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/fullsize2/KMT2A-MLL-Antibody-Western-Blot-NB600-248-img0008.jpg)
![Immunoprecipitation: KMT2A/MLL Antibody [NB600-248] - Samples: Nuclear Extract (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MLL1 antibody NB600-248 used for IP at 6 ug per reaction. MLL1 was also immunoprecipitated by rabbit anti-MLL1 antibody NB600-249. For blotting immunoprecipitated MLL1, NB600-248 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.](http://images.novusbio.com/fullsize2/KMT2A-MLL-Antibody-Western-Blot-NB600-248-img0009.jpg)
![Western Blot: HOXA7 Antibody (2F2) [H00003204-M01] - Analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.Lane 1: HOXA7 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/HOXA7 Antibody (2F2)-Western Blot-H00003204-M01-img0004.jpg)
![Sandwich ELISA: HOXA7 Antibody (2F2) [H00003204-M01] - Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/HOXA7-Antibody-(2F2)-Sandwich-ELISA-H00003204-M01-img0003.jpg)
![Western Blot: HOXA10 Overexpression Lysate (Adult Normal) [NBL1-11664] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HOXA10.](http://images.novusbio.com/fullsize/HOXA10 Overexpression Lysate (Adult Normal)-Western Blot-NBL1-11664-img0002.jpg)
![Western Blot: NUP98 Antibody [NB100-93325] - Detection of Human NUP96 on HeLa whole cell lysate using NB100-93325. NUP96 was also immunoprecipitated by rabbit anti-NUP96 antibody NB100-93326.](http://images.novusbio.com/fullsize2/NUP98-Antibody-Western-Blot-NB100-93325-img0002.jpg)
![Western Blot: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - WB analysis of lysates from (A) Human Embryonic Kidney 293 / HEK293 and (B) Human Embryonic carcinoma NCCIT cell lines using Flt-3/Flk-2/CD135 antibody (clone 7E8.2C8) at 2ug/ml concentration. The antibody detected single specific bands in both samples at the expected molecular weight position.](http://images.novusbio.com/fullsize2/Flt-3-Flk-2-CD135-Antibody-(7E8.2C8)-Western-Blot-NBP2-42210-img0001.jpg)
![Immunohistochemistry-Paraffin: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver cancer using Flt-3/Flk-2/CD135 antibody (clone 7E2.2C8) at 15 ug/ml concentration. The antibody generated specific cytoplasmic immunostaining of FLT3 in the cancerous cells while the tumor stroma was largely negative for the staining.](http://images.novusbio.com/fullsize2/Flt-3-Flk-2-CD135-Antibody-(7E8.2C8)-Immunohistochemistry-Paraffin-NBP2-42210-img0003.jpg)
![Flow Cytometry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - HEK293 cells were stained (surface) with Flt-3/Flk-2/CD135 antibody (clone: 7E8.2C8; red) or isotype control (mouse IgG2 lambda; blue) and positive staining observed using PE conjugated mouse anti-IgG(H+L) secondary antibody. Live cells (PPI negative) were gated for analysis](http://images.novusbio.com/fullsize2/Flt-3-Flk-2-CD135-Antibody-(7E8.2C8)-Flow-Cytometry-NBP2-42210-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/fullsize2/CD34 Antibody (MEC 14.7)-Immunocytochemistry-Immunofluorescence-NB600-1071-img0003.jpg)
![Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.](http://images.novusbio.com/fullsize2/CD34-Antibody-(MEC-14.7)-Immunohistochemistry-Paraffin-NB600-1071-img0014.jpg)
![Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).](http://images.novusbio.com/fullsize2/CD34 Antibody (MEC 14.7)-Flow Cytometry-NB600-1071-img0002.jpg)
![SDS-Page: Recombinant Human HOXA13 Protein [H00003209-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00003209-Q01-1.jpg)
![Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/fullsize2/SUB1-Antibody-Western-Blot-NBP1-82454-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/SUB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82454-img0011.jpg)
![Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://images.novusbio.com/fullsize2/SUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-82454-img0015.jpg)
![Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.](http://images.novusbio.com/fullsize2/PBX1 Antibody (4A2)-Western Blot-H00005087-M01-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/PBX1-Antibody-(4A2)-Immunocytochemistry-Immunofluorescence-H00005087-M01-img0006.jpg)
![Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize2/PBX1-Antibody-(4A2)-Immunohistochemistry-Paraffin-H00005087-M01-img0008.jpg)
![Western Blot: MRPL28 Antibody [NBP1-82805] - Analysis using Anti-MRPL28 antibody NBP1-82805 (A) shows similar pattern to independent antibody NBP2-38760 (B).](http://images.novusbio.com/fullsize2/MRPL28 Antibody-Western Blot-NBP1-82805-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: MRPL28 Antibody [NBP1-82805] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize2/MRPL28-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82805-img0006.jpg)
![Immunohistochemistry-Paraffin: MRPL28 Antibody [NBP1-82805] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/MRPL28-Antibody-Immunohistochemistry-Paraffin-NBP1-82805-img0002.jpg)
![Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of NXT1 expression in transfected 293T cell line by NXT1 monoclonal antibody (M08), clone 4F11. Lane 1: NXT1 transfected lysatE (15.51 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/NXT1 Antibody (4F11)-Western Blot-H00029107-M08-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of monoclonal antibody to NXT1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize2/NXT1-Antibody-(4F11)-Immunocytochemistry-Immunofluorescence-H00029107-M08-img0004.jpg)
![Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi or non-transfected control. Blot probed with H00029107-M08. GAPDH (36.1 kDa) used as loading control.](http://images.novusbio.com/fullsize2/NXT1-Antibody-(4F11)-Western-Blot-H00029107-M08-img0002.jpg)
![Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/fullsize2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Immunocytochemistry-Immunofluorescence-NBP1-30141-img0011.jpg)
![Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/fullsize2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Immunohistochemistry-Paraffin-NBP1-30141-img0010.jpg)
![Western Blot: p19ARF Antibody [NB200-106] - Analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Western-Blot-NB200-106-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0006.jpg)
![Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - Analysis of FFPE mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Immunohistochemistry-Paraffin-NB200-106-img0005.jpg)
![Western Blot: HOXA5 Antibody [NBP1-83235] - Analysis in control (vector only transfected HEK293T lysate) and HOXA5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412744).](http://images.novusbio.com/fullsize2/HOXA5-Antibody-Western-Blot-NBP1-83235-img0003.jpg)
![Immunohistochemistry-Paraffin: HOXA5 Antibody [NBP1-83235] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/HOXA5-Antibody-Immunohistochemistry-Paraffin-NBP1-83235-img0002.jpg)
![Western Blot: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in K562 cell lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/fullsize2/HOXB4-Antibody-Western-Blot-NBP2-24561-img0003.jpg)
![Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.](http://images.novusbio.com/fullsize2/HOXB4 Antibody-Immunohistochemistry-Paraffin-NBP2-24561-img0001.jpg)
![Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.](http://images.novusbio.com/fullsize2/c-Myb-Antibody-Western-Blot-NBP1-80306-img0004.jpg)
![Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://images.novusbio.com/fullsize2/c-Myb Antibody-Immunohistochemistry-Paraffin-NBP1-80306-img0003.jpg)
![Western Blot: c-Myb Antibody [NBP1-80306] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/fullsize2/c-Myb Antibody-Western Blot-NBP1-80306-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")