Home » HOXA9 » HOXA9 Antibodies » HOXA9 Antibody

HOXA9 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Immunocytochemistry/ Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells, glial cells were strongly stained..

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HOXA9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD
Specificity
Specificity of human, rat HOXA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.Use in Western blot reported in scientific literature (PMID 27832801).
Control Peptide
HOXA9 Protein (NBP2-32356PEP)
Publications
Read Publications using
NBP2-32356 in the following applications:

  • IHC
    1 publication
  • IHC-P
    1 publication
  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27832801)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXA9 Antibody

  • ABD-B
  • homeo box A9
  • homeobox A9
  • Homeobox protein Hox-1G
  • homeobox protein HOXA9
  • homeobox protein Hox-A9
  • homeodomain protein HOXA9
  • HOX1
  • HOX1.7
  • HOX1GMGC1934

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MEIS1 Antibody
NBP2-24597
Western Blot: MEIS1 Antibody [NBP2-24597] - Analysis of MEIS1 in mouse embryo brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24597 at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: MEIS1 Antibody [NBP2-24597] - Analysis of MEIS1 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
KMT2A/MLL Antibody
NB600-248
Western Blot: KMT2A/MLL Antibody [NB600-248] - Samples: Nuclear extract (50 and 15 ug) from HeLa, 293T, and Jurkat cells. Antibody: Affinity purified rabbit anti-MLL1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: KMT2A/MLL Antibody [NB600-248] - Samples: Nuclear Extract (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MLL1 antibody NB600-248 used for IP at 6 ug per reaction. MLL1 was also immunoprecipitated by rabbit anti-MLL1 antibody NB600-249. For blotting immunoprecipitated MLL1, NB600-248 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(1 Review)
(25 Publications)
Species: Hu
Applications: WB, IP
HOXA7 Antibody
(2F2)
H00003204-M01
Western Blot: HOXA7 Antibody (2F2) [H00003204-M01] - Analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.Lane 1: HOXA7 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: HOXA7 Antibody (2F2) [H00003204-M01] - Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA
HOXA10
Overexpression Lysate
NBL1-11664
Western Blot: HOXA10 Overexpression Lysate (Adult Normal) [NBL1-11664] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HOXA10.
Species: Hu
NUP98 Antibody
NB100-93325
Western Blot: NUP98 Antibody [NB100-93325] - Detection of Human NUP96 on HeLa whole cell lysate using NB100-93325. NUP96 was also immunoprecipitated by rabbit anti-NUP96 antibody NB100-93326.
(1 Publication)
Species: Hu
Applications: WB, IP
Flt-3/Flk-2/CD135
Antibody (7E8.2C8)
NBP2-42210
Western Blot: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - WB analysis of lysates from (A) Human Embryonic Kidney 293 / HEK293 and (B) Human Embryonic carcinoma NCCIT cell lines using Flt-3/Flk-2/CD135 antibody (clone 7E8.2C8) at 2ug/ml concentration. The antibody detected single specific bands in both samples at the expected molecular weight position.
Immunohistochemistry-Paraffin: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver cancer using Flt-3/Flk-2/CD135 antibody (clone 7E2.2C8) at 15 ug/ml concentration. The antibody generated specific cytoplasmic immunostaining of FLT3 in the cancerous cells while the tumor stroma was largely negative for the staining.
Flow Cytometry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - HEK293 cells were stained (surface) with Flt-3/Flk-2/CD135 antibody (clone: 7E8.2C8; red) or isotype control (mouse IgG2 lambda; blue) and positive staining observed using PE conjugated mouse anti-IgG(H+L) secondary antibody. Live cells (PPI negative) were gated for analysis
Species: Hu
Applications: WB, Flow, IHC, IHC-P
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(17 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Western Blot: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CDKN2B.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by CDKN2B antibody.
Species: Hu
Applications: WB, Flow, IHC
Recombinant Human
HOXA13 Protein
H00003209-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human breast shows strong nuclear positivity in glandular cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PBX1 Antibody (4A2)
H00005087-M01
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
(8 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MRPL28 Antibody
NBP1-82805
Western Blot: MRPL28 Antibody [NBP1-82805] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: MRPL28 Antibody [NBP1-82805] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPL28 Antibody [NBP1-82805] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NXT1 Antibody
(4F11)
H00029107-M08
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of NXT1 expression in transfected 293T cell line by NXT1 monoclonal antibody (M08), clone 4F11. Lane 1: NXT1 transfected lysatE (15.51 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of monoclonal antibody to NXT1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi or non-transfected control. Blot probed with H00029107-M08. GAPDH (36.1 kDa) used as loading control.
Species: Hu
Applications: WB, ELISA, ICC/IF
Blood group H
inhibitor Antibody
NBP1-57016
Western Blot: Blood group H inhibitor Antibody [NBP1-57016] - Human Heart lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
HOXA5 Antibody
NBP1-83235
Western Blot: HOXA5 Antibody [NBP1-83235] - Analysis in control (vector only transfected HEK293T lysate) and HOXA5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412744).
Immunohistochemistry-Paraffin: HOXA5 Antibody [NBP1-83235] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
HOXB4 Antibody
NBP2-24561
Western Blot: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in K562 cell lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
c-Myb Antibody
NBP1-80306
Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.
Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: c-Myb Antibody [NBP1-80306] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P, KD
HOXA9 Antibody
NBP2-32356
HOXA9 Antibody
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXA9 Antibody (NBP2-32356)(3)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 3 applications: IHC, IHC-P, WB.


Filter By Application
IHC
(1)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
Rat
(1)
All Species

Reviews for HOXA9 Antibody (NBP2-32356) (0)

There are no reviews for HOXA9 Antibody (NBP2-32356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXA9 Antibody (NBP2-32356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA9 Products

Bioinformatics Tool for HOXA9 Antibody (NBP2-32356)

Discover related pathways, diseases and genes to HOXA9 Antibody (NBP2-32356). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA9 Antibody (NBP2-32356)

Discover more about diseases related to HOXA9 Antibody (NBP2-32356).
 

Pathways for HOXA9 Antibody (NBP2-32356)

View related products by pathway.

PTMs for HOXA9 Antibody (NBP2-32356)

Learn more about PTMs related to HOXA9 Antibody (NBP2-32356).
 

Research Areas for HOXA9 Antibody (NBP2-32356)

Find related products by research area.

Blogs on HOXA9

There are no specific blogs for HOXA9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HOXA9