HOXA9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells, glial cells were strongly stained..

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXA9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.Use in Western blot reported in scientific literature (PMID 27832801).
Control Peptide
HOXA9 Protein (NBP2-32356PEP)
Publications
Read Publications using
NBP2-32356 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27832801)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXA9 Antibody

  • ABD-B
  • homeo box A9
  • homeobox A9
  • Homeobox protein Hox-1G
  • homeobox protein HOXA9
  • homeobox protein Hox-A9
  • homeodomain protein HOXA9
  • HOX1
  • HOX1.7
  • HOX1GMGC1934

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBL1-11664
Species: Hu
NB100-93325
Species: Hu
Applications: WB, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32356
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXA9 Antibody (NBP2-32356)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for HOXA9 Antibody (NBP2-32356) (0)

There are no reviews for HOXA9 Antibody (NBP2-32356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXA9 Antibody (NBP2-32356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA9 Products

Bioinformatics Tool for HOXA9 Antibody (NBP2-32356)

Discover related pathways, diseases and genes to HOXA9 Antibody (NBP2-32356). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA9 Antibody (NBP2-32356)

Discover more about diseases related to HOXA9 Antibody (NBP2-32356).
 

Pathways for HOXA9 Antibody (NBP2-32356)

View related products by pathway.

PTMs for HOXA9 Antibody (NBP2-32356)

Learn more about PTMs related to HOXA9 Antibody (NBP2-32356).
 

Research Areas for HOXA9 Antibody (NBP2-32356)

Find related products by research area.

Blogs on HOXA9

There are no specific blogs for HOXA9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA9