Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD
Specificity
Specificity of human HOXA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 27832801).
Rat reactivity reported in scientific literature (PMID: 27832801).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for HOXA9 Antibody
ABD-B
homeo box A9
homeobox A9
Homeobox protein Hox-1G
homeobox protein HOXA9
homeobox protein Hox-A9
homeodomain protein HOXA9
HOX1
HOX1.7
HOX1GMGC1934
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for HOXA9 Antibody (NBP2-32356)
Discover related pathways, diseases and genes to HOXA9 Antibody (NBP2-32356). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HOXA9 Antibody (NBP2-32356)
Discover more about diseases related to HOXA9 Antibody (NBP2-32356).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HOXA9 Antibody and receive a gift card or discount.
PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation
Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally.