HOXA9 Antibody

Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.

Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HOXA9 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD
• Predicted Species: Mouse (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXA9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 27832801).
• Control Peptide:

  HOXA9 Protein (NBP2-32356PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27832801).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HOXA9 Antibody

• ABD-B
• homeo box A9
• homeobox A9
• Homeobox protein Hox-1G
• homeobox protein HOXA9
• homeobox protein Hox-A9
• homeodomain protein HOXA9
• HOX1
• HOX1.7
• HOX1GMGC1934

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXA9 Antibody (NBP2-32356)(5)

Publications using NBP2-32356

• Franklin R, Guo Y, He S et al. Regulation of chromatin accessibility by the histone chaperone CAF-1 sustains lineage fidelity Nature Communications Dec 1 2022 [PMID: 35487911] (WB, Mouse)
• Lua X, Lianga B, Lib S et al. Modulation of HOXA9 after skeletal muscle denervation and reinnervation Am J Physiol Cell Physiol. [PMID: 32233950] (WB)
• Watanabe Y, Saito M, Saito K, Matsumoto Y. Upregulated HOXA9 expression is associated with lymph node metastasis in colorectal cancer. Oncol Lett. 2018 Mar 01 [PMID: 29435001] (IHC-P, Human)
• Mohr S, Doebele C, Comoglio F et al. Hoxa9 and Meis1 Cooperatively Induce Addiction to Syk Signaling by Suppressing miR-146a in Acute Myeloid Leukemia. Cancer Cell. Apr 10 2017 [PMID: 28399410] (IHC, Human)
• Molino Y, Jabes F, Bonnet A et al. Gene expression comparison reveals distinct basal expression of HOX members and differential TNF-induced response between brain- and spinal cord-derived microvascular endothelial cells. J Neuroinflammation. Nov 10 2016 [PMID: 27832801] (WB, Rat)

Bioinformatics

• Gene Symbol: HOXA9