HOXA9 Antibody

Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.

Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Discontinued

HOXA9 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXA9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 27832801).

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35487911). Rat reactivity reported in scientific literature (PMID: 27832801).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HOXA9 Antibody

• ABD-B
• homeo box A9
• homeobox A9
• Homeobox protein Hox-1G
• homeobox protein HOXA9
• homeobox protein Hox-A9
• homeodomain protein HOXA9
• HOX1
• HOX1.7
• HOX1GMGC1934

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters namedA, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated duringembryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcriptionfactor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to theabdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and theNUP98 gene has been associated with myeloid leukemogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXA9 Antibody (NBP2-32356)(6)

Publications using NBP2-32356

• Ting CY, Tan SY, Gan GG et al. Downregulation of hsa-miR-548d-3p and overexpression of HOXA9 in diffuse large B-cell lymphoma patients and the risk of R-CHOP chemotherapy resistance and disease progression International journal of laboratory hematology 2022-07-13 [PMID: 35830966]
• Franklin R, Guo Y, He S et al. Regulation of chromatin accessibility by the histone chaperone CAF-1 sustains lineage fidelity Nature Communications 2022-12-01 [PMID: 35487911] (WB, Mouse)
• Lua X, Lianga B, Lib S et al. Modulation of HOXA9 after skeletal muscle denervation and reinnervation Am J Physiol Cell Physiol. [PMID: 32233950] (WB)
• Watanabe Y, Saito M, Saito K, Matsumoto Y. Upregulated HOXA9 expression is associated with lymph node metastasis in colorectal cancer. Oncol Lett. 2018-03-01 [PMID: 29435001] (IHC-P, Human)
• Mohr S, Doebele C, Comoglio F et al. Hoxa9 and Meis1 Cooperatively Induce Addiction to Syk Signaling by Suppressing miR-146a in Acute Myeloid Leukemia. Cancer Cell. 2017-04-10 [PMID: 28399410] (IF/IHC, Human)
• Molino Y, Jabes F, Bonnet A et al. Gene expression comparison reveals distinct basal expression of HOX members and differential TNF-induced response between brain- and spinal cord-derived microvascular endothelial cells. J Neuroinflammation. 2016-11-10 [PMID: 27832801] (WB, Rat)

Bioinformatics

• Gene Symbol: HOXA9