![Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining in human tonsil and skeletal muscle tissues using NBP2-14410 antibody. Corresponding HMCES RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HMCES-Antibody-Immunohistochemistry-Paraffin-NBP2-14410-img0012.jpg "Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining in human tonsil and skeletal muscle tissues using NBP2-14410 antibody. Corresponding HMCES RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, Mycoplasma |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit HMCES Antibody - BSA Free (NBP2-14410) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-HMCES Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HMCES |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-14410 | Applications | Species |
|---|---|---|
| Miyoshi T, Makino T, Moran JV Poly(ADP-Ribose) Polymerase 2 Recruits Replication Protein A to Sites of LINE-1 Integration to Facilitate Retrotransposition Mol. Cell 2019-08-13 [PMID: 31473101] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HMCES |
![Western Blot: HMCES Antibody [NBP2-14410] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HMCES antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/HMCES-Antibody-Western-Blot-NBP2-14410-img0007.jpg "Western Blot: HMCES Antibody [NBP2-14410] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HMCES antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: HMCES Antibody [NBP2-14410] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/HMCES-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14410-img0006.jpg "Immunocytochemistry/Immunofluorescence: HMCES Antibody [NBP2-14410] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/HMCES-Antibody-Immunohistochemistry-Paraffin-NBP2-14410-img0008.jpg "Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/HMCES-Antibody-Immunohistochemistry-Paraffin-NBP2-14410-img0009.jpg "Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/HMCES-Antibody-Immunohistochemistry-Paraffin-NBP2-14410-img0010.jpg "Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/HMCES-Antibody-Immunohistochemistry-Paraffin-NBP2-14410-img0011.jpg "Immunohistochemistry-Paraffin: HMCES Antibody [NBP2-14410] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")