Histone H3.3B Antibody (2D7-H1)

Western Blot: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Analysis of H3F3B expression in transfected 293T cell line by H3F3B monoclonal antibody (M01), clone 2D7-H1.Lane 1: H3F3B transfected lysate(15 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Analysis of monoclonal antibody to H3F3B on HeLa cell . Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Analysis of monoclonal antibody to H3F3B on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.

ELISA: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Detection limit for recombinant GST tagged H3F3B is 1 ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Bv, Dr, Xp
• Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
• Clone: 2D7-H1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Histone H3.3B Antibody (2D7-H1) Summary

• Immunogen: H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
• Specificity: H3F3B - H3 histone, family 3B (H3.3B)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: H3F3B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockout Validated
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P, IF and ELISA. Knock Out Validation was reported in scientific literature (PMID: 26159997).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23903189). Xenopus reactivity reported in scientific literature (PMID: 23102146). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H3.3B Antibody (2D7-H1)

• H3 histone, family 3A
• H3 histone, family 3B (H3.3B)
• H3.3BH3.3A
• H3F3
• H3F3A
• histone H3.3

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is poyadenylated, unlike most histone genes. The protein encoded is a member of the histone H3 family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Histone H3.3B Antibody (H00003021-M01)(10)

Publications using H00003021-M01

• Zhang K, Wang H, Rajput SK et al. Characterization of H3.3 and HIRA expression and function in bovine early embryos. Mol Reprod Dev 2017-12-12 [PMID: 29232016]
• Pradhan SK, Su T, Yen L et al. EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation. Molecular Cell 2015-12-06 [PMID: 26669263]
• Jang C, Shibata Y, Starmer J et al. Histone H3.3 maintains genome integrity during mammalian development. Genes Dev 2015-07-01 [PMID: 26159997] (KO, Mouse)
• Hammoud SS, Low DH, Yi C et al. Chromatin and Transcription Transitions of Mammalian Adult Germline Stem Cells and Spermatogenesis. Cell Stem Cell. 2014-05-14 [PMID: 24835570]
• Lin CJ, Conti M, Ramalho-Santos M. Histone variant H3.3 maintains a decondensed chromatin state essential for mouse preimplantation development. Development. 2013-09-01 [PMID: 23903189] (Mouse)
• Orsi GA, Algazeery A, Meyer RE et al. Drosophila Yemanuclein and HIRA Cooperate for De Novo Assembly of H3.3-Containing Nucleosomes in the Male Pronucleus. PLoS Genet. 2013-02-07 [PMID: 23408912]
• Jullien J, Astrand C, Szenker E et al. HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes. Epigenetics Chromatin. 2012-01-01 [PMID: 23102146] (Xenopus)
• Szenker E, Lacoste N, Almouzni G. A Developmental Requirement for HIRA-Dependent H3.3 Deposition Revealed at Gastrulation inXenopus. Cell Reports. 2012-01-01 [PMID: 22813747]
• Sabirzhanov B, Keifer J. Cloning and Characterization of Glutamate Receptor Subunit 4 (GLUA4) and its Alternatively Spliced Isoforms in Turtle Brain. J Mol Neurosci. 2010-06-15 [PMID: 20549383]
• Drane P, Ouararhni K, Depaux A et al. The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3. Genes Dev. 2010-06-15 [PMID: 20504901]

Bioinformatics

• Gene Symbol: H3F3B
• Entrez:
  • 3021(Human)
• OMIM:
  • 601058(Human)
• Uniprot:
  • AAH17558(Human)