Histone H3.3B Antibody (2D7-H1)

Images

 
Western Blot: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Analysis of H3F3B expression in transfected 293T cell line by H3F3B monoclonal antibody (M01), clone 2D7-H1.Lane 1: H3F3B transfected lysate(15 KDa).Lane ...read more
Immunocytochemistry/ Immunofluorescence: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Analysis of monoclonal antibody to H3F3B on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Analysis of monoclonal antibody to H3F3B on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
ELISA: Histone H3.3B Antibody (2D7-H1) [H00003021-M01] - Detection limit for recombinant GST tagged H3F3B is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, XpSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, KO
Clone
2D7-H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Histone H3.3B Antibody (2D7-H1) Summary

Immunogen
H3F3B (AAH17558, 1 a.a. - 136 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Specificity
H3F3B - H3 histone, family 3B (H3.3B)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
H3F3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Knockout Validated
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P, IF and ELISA. Knock Out Validation was reported in scientific literature (PMID: 26159997).
Publications
Read Publications using
H00003021-M01 in the following applications:

  • KO
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23903189). Xenopus reactivity reported in scientific literature (PMID: 23102146). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H3.3B Antibody (2D7-H1)

  • H3 histone, family 3A
  • H3 histone, family 3B (H3.3B)
  • H3.3BH3.3A
  • H3F3
  • H3F3A
  • histone H3.3

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is poyadenylated, unlike most histone genes. The protein encoded is a member of the histone H3 family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-07996
Species: Hu
NB100-81964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-07993
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07995
Species: Hu
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB21-1023
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NBP2-16840
Species: Hu, Mu, Rt
Applications: WB, DB, EM, ICC/IF, IHC, IHC-Fr, IHC-P
H00008351-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-07994
Species: Hu
NBL1-11566
Species: Hu
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Histone H3.3B Antibody (H00003021-M01)(9)

We have publications tested in 2 confirmed species: Mouse, Xenopus.

We have publications tested in 1 application: KO.


Filter By Application
KO
(1)
All Applications
Filter By Species
Mouse
(2)
Xenopus
(1)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00003021-M01 Applications Species
Pradhan SK, Su T, Yen L et al. EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation. Molecular Cell 2015 Dec 6 [PMID: 26669263]
Jang C, Shibata Y, Starmer J et al. Histone H3.3 maintains genome integrity during mammalian development. Genes Dev 2015 Jul 1 [PMID: 26159997] (KO, Mouse) KO Mouse
Hammoud SS, Low DH, Yi C et al. Chromatin and Transcription Transitions of Mammalian Adult Germline Stem Cells and Spermatogenesis. Cell Stem Cell. 2014 May 14 [PMID: 24835570]
Lin CJ, Conti M, Ramalho-Santos M. Histone variant H3.3 maintains a decondensed chromatin state essential for mouse preimplantation development. Development. 2013 Sep [PMID: 23903189] (Mouse) Mouse
Orsi GA, Algazeery A, Meyer RE et al. Drosophila Yemanuclein and HIRA Cooperate for De Novo Assembly of H3.3-Containing Nucleosomes in the Male Pronucleus. PLoS Genet. 2013 Feb 07 [PMID: 23408912]
Jullien J, Astrand C, Szenker E et al. HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes. Epigenetics Chromatin. 2012 [PMID: 23102146] (Xenopus) Xenopus
Szenker E, Lacoste N, Almouzni G. A Developmental Requirement for HIRA-Dependent H3.3 Deposition Revealed at Gastrulation inXenopus. Cell Reports. 2012 [PMID: 22813747]
Sabirzhanov B, Keifer J. Cloning and Characterization of Glutamate Receptor Subunit 4 (GLUA4) and its Alternatively Spliced Isoforms in Turtle Brain. J Mol Neurosci. 2010 Jun 15. [PMID: 20549383]
Drane P, Ouararhni K, Depaux A et al. The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3. Genes Dev. 2010 Jun 15 [PMID: 20504901]

Reviews for Histone H3.3B Antibody (H00003021-M01) (0)

There are no reviews for Histone H3.3B Antibody (H00003021-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Histone H3.3B Antibody (H00003021-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone H3.3B Products

Bioinformatics Tool for Histone H3.3B Antibody (H00003021-M01)

Discover related pathways, diseases and genes to Histone H3.3B Antibody (H00003021-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H3.3B Antibody (H00003021-M01)

Discover more about diseases related to Histone H3.3B Antibody (H00003021-M01).
 

Pathways for Histone H3.3B Antibody (H00003021-M01)

View related products by pathway.

Research Areas for Histone H3.3B Antibody (H00003021-M01)

Find related products by research area.

Blogs on Histone H3.3B

There are no specific blogs for Histone H3.3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H3.3B Antibody (2D7-H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol H3F3B
Entrez
OMIM
Uniprot