Histone H2AY/macroH2A.1 Recombinant Protein Antigen

Images

 
There are currently no images for Histone H2AY/macroH2A.1 Recombinant Protein Antigen (NBP2-56819PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Histone H2AY/macroH2A.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Histone H2AY/macroH2A.1.

Source: E. coli

Amino Acid Sequence: GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MACROH2A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56819.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Histone H2AY/macroH2A.1 Recombinant Protein Antigen

  • core histone macro-H2A.1
  • H2A histone family, member Y
  • H2A.y
  • H2A/y
  • H2AF12M
  • H2AFJ
  • H2AFY
  • Histone H2A.y
  • Histone H2AY
  • Histone MacroH2A1
  • histone macroH2A1.1
  • histone macroH2A1.2
  • MACROH2A1
  • MACROH2A1.1
  • macroH2A1.2
  • Medulloblastoma Antigen MU-MB-50.205
  • mH2A1

Background

macroH2A.1 (H2AFY) is 372 amino acids long, weighs approximately 40 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. macroH2a.1 has two shorter isoforms meeasuring 371 and 369 amino acids long, both weighing approximately 39 kDa. Current studies are being done on several diseases and disorders including medulloblastoma, lupus erythematosus, Huntington's disease, immunodeficiency, melanoma, and malaria. macroH2A.1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the chromatin regulation/ acetylation, systemic lupus erythematosus, and ATF-2 transcription factor pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
1129-ER
Species: Hu
Applications: BA
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
AF5215
Species: Hu, Mu
Applications: ICC, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-37322
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-14900
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008405-B01P
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-48615
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-15255
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-56819PEP
Species: Hu
Applications: AC

Publications for Histone H2AY/macroH2A.1 Recombinant Protein Antigen (NBP2-56819PEP) (0)

There are no publications for Histone H2AY/macroH2A.1 Recombinant Protein Antigen (NBP2-56819PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H2AY/macroH2A.1 Recombinant Protein Antigen (NBP2-56819PEP) (0)

There are no reviews for Histone H2AY/macroH2A.1 Recombinant Protein Antigen (NBP2-56819PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Histone H2AY/macroH2A.1 Recombinant Protein Antigen (NBP2-56819PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Histone H2AY/macroH2A.1 Products

Blogs on Histone H2AY/macroH2A.1

There are no specific blogs for Histone H2AY/macroH2A.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Histone H2AY/macroH2A.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MACROH2A1