Recombinant Human Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Protein

Product Discontinued

Recombinant Human Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-307 of Human HS3ST1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: HS3ST1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Protein

• 3OST
• 3OST1
• 3-OST-1
• 3OST1Heparan sulfate 3-O-sulfotransferase 1
• EC 2.8.2
• EC 2.8.2.23
• h3-OST-1
• heparan sulfate (glucosamine) 3-O-sulfotransferase 1
• Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1
• heparan sulfate glucosamine 3-O-sulfotransferase 1
• heparin-glucosamine 3-O-sulfotransferase
• HS3ST1

Background

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HS3ST1