HECTD1 Antibody (1E10) - Azide and BSA Free

ELISA: HECTD1 Antibody (1E10) [H00025831-M03] - Detection limit for recombinant GST tagged HECTD1 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clone: 1E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HECTD1 Antibody (1E10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse HECTD1 Antibody (1E10) - Azide and BSA Free (H00025831-M03) is a monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. Anti-HECTD1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: HECTD1 (NP_056197, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
• Specificity: HECTD1 - HECT domain containing 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HECTD1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24855001). Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 22431752)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24855001) Other species not tested. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HECTD1 Antibody (1E10) - Azide and BSA Free

• E3 ligase for inhibin receptor
• E3 ubiquitin-protein ligase HECTD1
• EC 6.3.2.-
• EULIR
• HECT domain containing 1
• HECT domain-containing protein 1
• KIAA1131FLJ38315

Background

The HECTD1 gene encodes a2, 610 amino acid long, 298 kDA E3 ubiquitin-protein ligase HECTD1 protein that accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester. It then directly transmits the ubiquitin to targeted substrates and may be essential for development of the head mesenchyme and neural tube closure. HECTD1 interacts in interferon signaling and cytokine signaling in the immune system and is known to interact with various genes such as NME2, ERCC2, PITX2, CCNA2, and NME1-NME2. HECTD1 has been investigated in many diseases such as angelman syndrome, teratoma, carcinoma, malaria, and influenza.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HECTD1 Antibody (H00025831-M03)(6)

Publications using H00025831-M03

• Xinggang W, Christian G, Zanhui J et al. HECTD1 regulates the expression of SNAIL: Implications for epithelial-mesenchymal transition. Int J Oncol. 2020-02-27 [PMID: 32319576]
• Sugrue KF, Sarkar AA, Leatherbury L, Zohn IE. The ubiquitin ligase HECTD1 promotes retinoic acid signaling required for development of the aortic arch Dis Model Mech 2018-12-21 [PMID: 30578278] (IF/IHC, Mouse)
• Shen X, Jia Z, D'Alonzo D et al. HECTD1 controls the protein level of IQGAP1 to regulate the dynamics of adhesive structures. Cell Commun Signal 2017-01-05 [PMID: 28073378]
• Sarkar AA, Sabatino JA, Sugrue KF, Zohn IE Abnormal labyrinthine zone in the Hectd1-null placenta. Placenta 2016-02-01 [PMID: 26907377]
• Sarkar AA, Nuwayhid SJ, Maynard T et al. Hectd1 is required for development of the junctional zone of the placenta. Dev. Biol. 2014-05-20 [PMID: 24855001] (WB, IHC-Fr, Mouse)
• Sarkar AA, Zohn IE. Hectd1 regulates intracellular localization and secretion of Hsp90 to control cellular behavior of the cranial mesenchyme. J Cell Biol. 2012-03-19 [PMID: 22431752] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: HECTD1
• Entrez:
  • 25831(Human)
• Uniprot:
  • NP_056197(Human)