HECTD1 Antibody (1C7)

Images

 
Western Blot: HECTD1 Antibody (1C7) [H00025831-M08] - Detection against Immunogen (37.62 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HECTD1 Antibody (1C7) Summary

Immunogen
HECTD1 (NP_056197, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
Specificity
HECTD1 - HECT domain containing 1 (1C7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HECTD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HECTD1 Antibody (1C7)

  • E3 ligase for inhibin receptor
  • E3 ubiquitin-protein ligase HECTD1
  • EC 6.3.2.-
  • EULIR
  • HECT domain containing 1
  • HECT domain-containing protein 1
  • KIAA1131FLJ38315

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00025831-M08
Species: Hu
Applications: WB, ELISA

Publications for HECTD1 Antibody (H00025831-M08) (0)

There are no publications for HECTD1 Antibody (H00025831-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HECTD1 Antibody (H00025831-M08) (0)

There are no reviews for HECTD1 Antibody (H00025831-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HECTD1 Antibody (H00025831-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HECTD1 Products

Array H00025831-M08

Bioinformatics Tool for HECTD1 Antibody (H00025831-M08)

Discover related pathways, diseases and genes to HECTD1 Antibody (H00025831-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HECTD1 Antibody (H00025831-M08)

Discover more about diseases related to HECTD1 Antibody (H00025831-M08).
 

Pathways for HECTD1 Antibody (H00025831-M08)

View related products by pathway.

Blogs on HECTD1

There are no specific blogs for HECTD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HECTD1 Antibody (1C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol HECTD1
Entrez
Uniprot