H2BFWT Antibody

Images

 
Immunohistochemistry: H2BFWT Antibody [NBP2-30738] - Staining of human testis shows moderate nuclear positivity in subset of cells in seminiferus ducts and in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

H2BFWT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVL
Specificity
Specificity of human H2BFWT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
H2BFWT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for H2BFWT Antibody

  • H2B histone family member W testis-specific
  • H2B histone family, member W, testis-specific
  • histone H2B type W-T
  • MGC148130
  • MGC148131

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67753
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-61882
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-30738
Species: Hu
Applications: IHC, IHC-P

Publications for H2BFWT Antibody (NBP2-30738) (0)

There are no publications for H2BFWT Antibody (NBP2-30738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2BFWT Antibody (NBP2-30738) (0)

There are no reviews for H2BFWT Antibody (NBP2-30738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for H2BFWT Antibody (NBP2-30738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional H2BFWT Products

Array NBP2-30738

Bioinformatics Tool for H2BFWT Antibody (NBP2-30738)

Discover related pathways, diseases and genes to H2BFWT Antibody (NBP2-30738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H2BFWT Antibody (NBP2-30738)

Discover more about diseases related to H2BFWT Antibody (NBP2-30738).
 

Pathways for H2BFWT Antibody (NBP2-30738)

View related products by pathway.

Blogs on H2BFWT

There are no specific blogs for H2BFWT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H2BFWT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol H2BFWT
Uniprot