We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human H2A GST (N-Term) Protein

Images

 
SDS-Page: H2A Recombinant Protein [H00008337-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human H2A GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-130 of Human HIST2H2AA

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HIST2H2AA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
40.04 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human H2A GST (N-Term) Protein

  • H2A histone family, member O
  • H2A.2
  • H2A/O
  • H2A/q
  • H2a-615
  • H2AFOHistone H2A/o
  • HIST2H2AAH2A
  • histone 2, H2aa
  • histone 2, H2aa3
  • histone cluster 2, H2aa3
  • histone H2A type 2-A
  • Histone H2A.2

Background

HIST2H2AA( AAH01629, 1 a.a. - 131 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBL1-11570
Species: Hu
Applications: WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-67753
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for H2A Recombinant Protein (H00008337-P01) (0)

There are no publications for H2A Recombinant Protein (H00008337-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2A Recombinant Protein (H00008337-P01) (0)

There are no reviews for H2A Recombinant Protein (H00008337-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H2A Recombinant Protein (H00008337-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional H2A Products

Array H00008337-P01

Blogs on H2A.

H3.1t - A testis-specific histone variant
Histones are nuclear proteins essential for the storage and organization of genomic DNA as chromatin. Chromatin consists of DNA wrapped tightly around histone oligomers to form nucleosomes. In addition to compacting the genome, histones also regula...  Read full blog post.

H3.1 - A core histone essential for genome storage and organization
Histones are the main protein component of chromatin and are essential for the storage and compaction of the genome. DNA wraps around histone oligomers to make up nucleosomes, the individual subunits of chromatin. By altering the accessibility of t...  Read full blog post.

Histone H3
Eukaryotic chromosomes are formed through the highly organized and structural wrapping of DNA genetic material around histone proteins into the classic "bead on a string" globular structure of nucleosomes. The histone family consists of five family me...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human H2A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST2H2AA3