Recombinant Human H2A Protein

Images

 
SDS-Page: H2A Recombinant Protein [H00008337-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human H2A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-130 of Human HIST2H2AA full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HIST2H2AA3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human H2A Protein

  • H2A histone family, member O
  • H2A.2
  • H2A/O
  • H2A/q
  • H2a-615
  • H2AFOHistone H2A/o
  • HIST2H2AAH2A
  • histone 2, H2aa
  • histone 2, H2aa3
  • histone cluster 2, H2aa3
  • histone H2A type 2-A
  • Histone H2A.2

Background

HIST2H2AA( AAH01629, 1 a.a. - 131 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-07996
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBL1-11569
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56633
Species: Hu
Applications: WB
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00008337-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for H2A Recombinant Protein (H00008337-P01) (0)

There are no publications for H2A Recombinant Protein (H00008337-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2A Recombinant Protein (H00008337-P01) (0)

There are no reviews for H2A Recombinant Protein (H00008337-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H2A Recombinant Protein (H00008337-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional H2A Products

H2A H00008337-P01

Bioinformatics Tool for H2A Recombinant Protein (H00008337-P01)

Discover related pathways, diseases and genes to H2A Recombinant Protein (H00008337-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H2A Recombinant Protein (H00008337-P01)

Discover more about diseases related to H2A Recombinant Protein (H00008337-P01).

Blogs on H2A.

H3.1t - A testis-specific histone variant
Histones are nuclear proteins essential for the storage and organization of genomic DNA as chromatin. Chromatin consists of DNA wrapped tightly around histone oligomers to form nucleosomes. In addition to compacting the genome, histones also regula...  Read full blog post.

H3.1 - A core histone essential for genome storage and organization
Histones are the main protein component of chromatin and are essential for the storage and compaction of the genome. DNA wraps around histone oligomers to make up nucleosomes, the individual subunits of chromatin. By altering the accessibility of t...  Read full blog post.

Histone H3
Eukaryotic chromosomes are formed through the highly organized and structural wrapping of DNA genetic material around histone proteins into the classic "bead on a string" globular structure of nucleosomes. The histone family consists of five family me...  Read full blog post.

Customers Who Bought This Also Bought

H2A Antibody
NBP1-58095

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human H2A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST2H2AA3