GTF3C6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GTF3C6 Antibody [NBP2-31851] - Staining of human cell line HEK 293 shows localization to nuclear bodies. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GTF3C6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTF3C6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GTF3C6 Protein (NBP2-31851PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GTF3C6 Antibody - BSA Free

• bA397G5.3
• C6orf51chromosome 6 open reading frame 51
• general transcription factor 3C polypeptide 6
• general transcription factor IIIC, polypeptide 6, alpha 35kDa
• TFIIIC35TFIIIC 35 kDa subunit
• Transcription factor IIIC 35 kDa subunit
• transcription factor IIIC 35kDa
• Transcription factor IIIC subunit 6

Background

RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcriptionfactors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins(e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmicRNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viralorigin.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GTF3C6 Antibody (NBP2-31851)(2)

Publications using NBP2-31851

• Vidal R, Leen E, Herold S et al. Association with TFIIIC limits MYCN localization in hubs of active promoters and chromatin accumulation of non-phosphorylated RNA Polymerase II bioRxiv 2023-11-20 (SDS-Page)
• Vidal R, Leen E, Herold S, M�ller M, Fleischhauer D, Sch�lein-V�lk C, Papadopoulos D, R�schert I, Uhl L, Ade CP, Gallant P, Bayliss R, Eilers M, B�chel G. Association with TFIIIC limits MYCN localisation in hubs of active promoters and chromatin accumulation of non-phosphorylated RNA polymerase II Elife 2024-08-23 [PMID: 39177021]

Bioinformatics

• Gene Symbol: GTF3C6
• Uniprot:
  • Q969F1(Human)