| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit GTF3C6 Antibody - BSA Free (NBP2-31851) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-GTF3C6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GTF3C6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP2-31851 | Applications | Species |
|---|---|---|
| Vidal R, Leen E, Herold S et al. Association with TFIIIC limits MYCN localization in hubs of active promoters and chromatin accumulation of non-phosphorylated RNA Polymerase II bioRxiv 2023-11-20 (SDS-Page) | SDS-Page | |
| Vidal R, Leen E, Herold S, M�ller M, Fleischhauer D, Sch�lein-V�lk C, Papadopoulos D, R�schert I, Uhl L, Ade CP, Gallant P, Bayliss R, Eilers M, B�chel G. Association with TFIIIC limits MYCN localisation in hubs of active promoters and chromatin accumulation of non-phosphorylated RNA polymerase II Elife 2024-08-23 [PMID: 39177021] |
Secondary Antibodies |
Isotype Controls |
Research Areas for GTF3C6 Antibody (NBP2-31851)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.