GTF3C6 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: GTF3C6 Antibody [NBP2-31851] - Staining of human cell line HEK 293 shows localization to nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
ChIP-Exo-Seq composite graph for Anti-GTF3C6 (NBP2-31851) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

GTF3C6 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit GTF3C6 Antibody - BSA Free (NBP2-31851) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-GTF3C6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF3C6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTF3C6 Protein (NBP2-31851PEP)
Publications
Read Publications using NBP2-31851.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GTF3C6 Antibody - BSA Free

  • bA397G5.3
  • C6orf51chromosome 6 open reading frame 51
  • general transcription factor 3C polypeptide 6
  • general transcription factor IIIC, polypeptide 6, alpha 35kDa
  • TFIIIC35TFIIIC 35 kDa subunit
  • Transcription factor IIIC 35 kDa subunit
  • transcription factor IIIC 35kDa
  • Transcription factor IIIC subunit 6

Background

RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcriptionfactors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins(e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmicRNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viralorigin.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP (-), WB
NB100-60432
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-60435
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-31851
Species: Hu
Applications: ICC/IF, IHC, ChIP

Publications for GTF3C6 Antibody (NBP2-31851)(2)

We have publications tested in 1 application: SDS-Page.


Filter By Application
SDS-Page
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP2-31851 Applications Species
Vidal R, Leen E, Herold S et al. Association with TFIIIC limits MYCN localization in hubs of active promoters and chromatin accumulation of non-phosphorylated RNA Polymerase II bioRxiv 2023-11-20 (SDS-Page) SDS-Page
Vidal R, Leen E, Herold S, M�ller M, Fleischhauer D, Sch�lein-V�lk C, Papadopoulos D, R�schert I, Uhl L, Ade CP, Gallant P, Bayliss R, Eilers M, B�chel G. Association with TFIIIC limits MYCN localisation in hubs of active promoters and chromatin accumulation of non-phosphorylated RNA polymerase II Elife 2024-08-23 [PMID: 39177021]

Reviews for GTF3C6 Antibody (NBP2-31851) (0)

There are no reviews for GTF3C6 Antibody (NBP2-31851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GTF3C6 Antibody (NBP2-31851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTF3C6 Products

Research Areas for GTF3C6 Antibody (NBP2-31851)

Find related products by research area.

Blogs on GTF3C6

There are no specific blogs for GTF3C6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF3C6 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C6
Uniprot