GTF3C5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GTF3C5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GTF3C5 Antibody - BSA Free
Background
General transcription factor 3C polypeptide 5 (GTF3C5/TFIIIC63) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. GTF3C5/TFIIIC63 interacts with TFIIIB and may facilitate TFIIIB and RNA polymerase III recruitment in association with TFIIIC102, TFIIIB90, and RPC62.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP (-), WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for GTF3C5 Antibody (NBP2-55707) (0)
There are no publications for GTF3C5 Antibody (NBP2-55707).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GTF3C5 Antibody (NBP2-55707) (0)
There are no reviews for GTF3C5 Antibody (NBP2-55707).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GTF3C5 Antibody (NBP2-55707) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GTF3C5 Products
Blogs on GTF3C5