GTF3C5 Antibody

Images

 
Western Blot: GTF3C5 Antibody [NBP2-49504] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: GTF3C5 Antibody [NBP2-49504] - Staining of human cell line HaCaT shows localization to nucleoplasm.
Immunohistochemistry: GTF3C5 Antibody [NBP2-49504] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTF3C5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
Specificity
Specificity of human GTF3C5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF3C5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTF3C5 Recombinant Protein Antigen (NBP2-49504PEP)

Reactivity Notes

Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTF3C5 Antibody

  • FLJ20857
  • general transcription factor 3C polypeptide 5
  • general transcription factor IIIC, polypeptide 5 (63kD)
  • general transcription factor IIIC, polypeptide 5, 63kDa
  • TF3C-epsilon
  • TFiiiC2-63
  • TFIIIC63TFIIIC 63 kDa subunit
  • TFIIICepsilon
  • Transcription factor IIIC 63 kDa subunit
  • Transcription factor IIIC subunit epsilon
  • transcription factor IIIC, 63 kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60657
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P, IP
NB100-60432
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-31851
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009330-M01
Species: Hu, Mu
Applications: WB, ELISA

Publications for GTF3C5 Antibody (NBP2-49504) (0)

There are no publications for GTF3C5 Antibody (NBP2-49504).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF3C5 Antibody (NBP2-49504) (0)

There are no reviews for GTF3C5 Antibody (NBP2-49504). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTF3C5 Antibody (NBP2-49504) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GTF3C5 Antibody (NBP2-49504)

Discover related pathways, diseases and genes to GTF3C5 Antibody (NBP2-49504). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GTF3C5

There are no specific blogs for GTF3C5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF3C5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C5