GNAI3 Antibody - BSA Free

Western Blot: GNAI3 Antibody [NBP2-82238] - Host: Rabbit. Target Name: GNAI3. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GNAI3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAI3. Peptide sequence: VIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNAI3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GNAI3 Antibody - BSA Free

• FLJ26559
• G(i) alpha-3
• guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 3,87U6
• guanine nucleotide-binding protein G(k) subunit alpha

Background

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in varioustransmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K(+) channels

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNAI3