GlyBP Antibody


Western Blot: GlyBP Antibody [NBP2-84987] - Host: Rabbit. Target Name: CEP104. Sample Tissue: Human 721_B Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GlyBP Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GlyBP. Peptide sequence: SLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLI
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for GlyBP Antibody

  • GlyBP
  • glycine-, glutamate-, thienylcyclohexylpiperidine-binding protein
  • KIAA0562
  • RP1-286D6.4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GlyBP Antibody (NBP2-84987) (0)

There are no publications for GlyBP Antibody (NBP2-84987).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GlyBP Antibody (NBP2-84987) (0)

There are no reviews for GlyBP Antibody (NBP2-84987). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GlyBP Antibody (NBP2-84987) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GlyBP Products

Bioinformatics Tool for GlyBP Antibody (NBP2-84987)

Discover related pathways, diseases and genes to GlyBP Antibody (NBP2-84987). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GlyBP

There are no specific blogs for GlyBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GlyBP Antibody and receive a gift card or discount.


Gene Symbol CEP104