Gamma Adaptin Antibody

Images

 
Genetic Strategies: Western Blot: Gamma Adaptin Antibody [NBP2-58947] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: Gamma Adaptin Antibody [NBP2-58947] - Staining of human cell line U-2 OS shows localization to vesicles.
Western Blot: Gamma Adaptin Antibody [NBP2-58947] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Gamma Adaptin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI
Specificity
Specificity of human Gamma Adaptin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP1G1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Gamma Adaptin Recombinant Protein Antigen (NBP2-58947PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Gamma Adaptin Antibody

  • Adapter-related protein complex 1 subunit gamma-1
  • Adaptor protein complex AP-1 subunit gamma-1
  • adaptor-related protein complex 1, gamma 1 subunit
  • ADTGclathrin assembly protein complex 1 gamma large chain
  • AP-1 complex subunit gamma-1
  • CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1
  • Clathrin assembly protein complex 1 gamma-1 large chain
  • gamma adaptin
  • gamma1-adaptin
  • golgi adaptor HA1/AP1 adaptin gamma subunit
  • Golgi adaptor HA1/AP1 adaptin subunit gamma-1
  • MGC18255

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81857
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14047
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90879
Species: Hu
Applications: IHC, IHC-P
NBP1-82745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-58645
Species: Hu
Applications: WB, ICC/IF

Publications for Gamma Adaptin Antibody (NBP2-58947) (0)

There are no publications for Gamma Adaptin Antibody (NBP2-58947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gamma Adaptin Antibody (NBP2-58947) (0)

There are no reviews for Gamma Adaptin Antibody (NBP2-58947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gamma Adaptin Antibody (NBP2-58947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Gamma Adaptin Antibody (NBP2-58947)

Discover related pathways, diseases and genes to Gamma Adaptin Antibody (NBP2-58947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Gamma Adaptin Antibody (NBP2-58947)

Find related products by research area.

Blogs on Gamma Adaptin

There are no specific blogs for Gamma Adaptin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gamma Adaptin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1G1