Gamma Adaptin Antibody

Western Blot: Gamma Adaptin Antibody [NBP2-58947] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-AP1G1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Gamma Adaptin Antibody [NBP2-58947] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Product Discontinued

Gamma Adaptin Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI
• Predicted Species: Mouse (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP1G1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Gamma Adaptin Antibody

• Adapter-related protein complex 1 subunit gamma-1
• Adaptor protein complex AP-1 subunit gamma-1
• adaptor-related protein complex 1, gamma 1 subunit
• ADTGclathrin assembly protein complex 1 gamma large chain
• AP-1 complex subunit gamma-1
• CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1
• Clathrin assembly protein complex 1 gamma-1 large chain
• gamma adaptin
• gamma1-adaptin
• golgi adaptor HA1/AP1 adaptin gamma subunit
• Golgi adaptor HA1/AP1 adaptin subunit gamma-1
• MGC18255

Background

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta, beta prime and gamma adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP1G1