Gamma Adaptin Antibody


Genetic Strategies: Western Blot: Gamma Adaptin Antibody [NBP2-58947] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: Gamma Adaptin Antibody [NBP2-58947] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Validated by:

Genetic Strategies


Order Details

Gamma Adaptin Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI
Specificity of human Gamma Adaptin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Gamma Adaptin Recombinant Protein Antigen (NBP2-58947PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Gamma Adaptin Antibody

  • Adapter-related protein complex 1 subunit gamma-1
  • Adaptor protein complex AP-1 subunit gamma-1
  • adaptor-related protein complex 1, gamma 1 subunit
  • ADTGclathrin assembly protein complex 1 gamma large chain
  • AP-1 complex subunit gamma-1
  • CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1
  • Clathrin assembly protein complex 1 gamma-1 large chain
  • gamma adaptin
  • gamma1-adaptin
  • golgi adaptor HA1/AP1 adaptin gamma subunit
  • Golgi adaptor HA1/AP1 adaptin subunit gamma-1
  • MGC18255


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu
Applications: WB, ICC/IF

Publications for Gamma Adaptin Antibody (NBP2-58947) (0)

There are no publications for Gamma Adaptin Antibody (NBP2-58947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gamma Adaptin Antibody (NBP2-58947) (0)

There are no reviews for Gamma Adaptin Antibody (NBP2-58947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gamma Adaptin Antibody (NBP2-58947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Gamma Adaptin Antibody (NBP2-58947)

Discover related pathways, diseases and genes to Gamma Adaptin Antibody (NBP2-58947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Gamma Adaptin Antibody (NBP2-58947)

Find related products by research area.

Blogs on Gamma Adaptin

There are no specific blogs for Gamma Adaptin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Gamma Adaptin Antibody and receive a gift card or discount.


Gene Symbol AP1G1