GAGE1 Recombinant Protein Antigen

Images

 
There are currently no images for GAGE1 Recombinant Protein Antigen (NBP2-54704PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GAGE1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAGE1

Source: E. coli

Amino Acid Sequence: PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GAGE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54704.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GAGE1 Recombinant Protein Antigen

  • Antigen MZ2-F
  • Cancer/testis antigen 4.1
  • G antigen 1
  • GAGE-1
  • member 1
  • MGC33825
  • MZ2-F antigen

Background

GAGE1 belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-38158
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-98298
Species: Hu
Applications: WB
NBP3-20167
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-94448
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-62688
Species: Hu
Applications: IHC,  IHC-P
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-42950
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-30151
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89062
Species: Hu
Applications: IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP3-46274
Species: Hu
Applications: ELISA, IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-54704PEP
Species: Hu
Applications: AC

Publications for GAGE1 Recombinant Protein Antigen (NBP2-54704PEP) (0)

There are no publications for GAGE1 Recombinant Protein Antigen (NBP2-54704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAGE1 Recombinant Protein Antigen (NBP2-54704PEP) (0)

There are no reviews for GAGE1 Recombinant Protein Antigen (NBP2-54704PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GAGE1 Recombinant Protein Antigen (NBP2-54704PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAGE1 Products

Research Areas for GAGE1 Recombinant Protein Antigen (NBP2-54704PEP)

Find related products by research area.

Blogs on GAGE1

There are no specific blogs for GAGE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GAGE1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GAGE1