Fucosyltransferase 5/FUT5 Antibody (1H6) - Azide and BSA Free

Sandwich ELISA: Fucosyltransferase 5/FUT5 Antibody (1H6) [H00002527-M03] - Detection limit for recombinant GST tagged FUT5 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1H6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Fucosyltransferase 5/FUT5 Antibody (1H6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FUT5 (NP_002025, 95 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDG
• Specificity: Reacts with fucosyltransferase 5 (alpha (1,3) fucosyltransferase).
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FUT5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fucosyltransferase 5/FUT5 Antibody (1H6) - Azide and BSA Free

• alpha (1,3) fucosyltransferase
• alpha-(1,3)-fucosyltransferase
• EC 2.4.1
• EC 2.4.1.65
• fucosyltransferase 5 (alpha (1,3) fucosyltransferase)
• Fucosyltransferase 5
• Fucosyltransferase V
• FUC-TV
• fucT-V
• FUT5
• Galactoside 3-L-fucosyltransferase

Background

FUT5 - fucosyltransferase 5 (alpha (1,3) fucosyltransferase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FUT5
• Entrez:
  • 2527(Human)
• Uniprot:
  • NP_002025(Human)