Recombinant Human FLJ25006 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FLJ25006 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 274 of Human FLJ25006 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLGDSWQGKRHLFIMCSYCSTDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDERGHLKLTDFGLSRHVPQGAQAYTICGTLQYMGERG

Protein/Peptide Type
Recombinant Protein
Gene
SGK494

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Hepes, 100 mM NaCl, pH 7.5, 5 mM DTT, 4 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FLJ25006 Protein

  • FLJ25006
  • FLJ78978
  • MGC39533
  • sugen kinase 494
  • uncharacterized serine/threonine-protein kinase SgK494

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-28740
Species: Hu
Applications: WB, IP
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84908
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00124923-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FLJ25006 Recombinant Protein (H00124923-P01) (0)

There are no publications for FLJ25006 Recombinant Protein (H00124923-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ25006 Recombinant Protein (H00124923-P01) (0)

There are no reviews for FLJ25006 Recombinant Protein (H00124923-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FLJ25006 Recombinant Protein (H00124923-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FLJ25006 Products

Bioinformatics Tool for FLJ25006 Recombinant Protein (H00124923-P01)

Discover related pathways, diseases and genes to FLJ25006 Recombinant Protein (H00124923-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ25006 Recombinant Protein (H00124923-P01)

Discover more about diseases related to FLJ25006 Recombinant Protein (H00124923-P01).
 

Pathways for FLJ25006 Recombinant Protein (H00124923-P01)

View related products by pathway.

Research Areas for FLJ25006 Recombinant Protein (H00124923-P01)

Find related products by research area.

Blogs on FLJ25006

There are no specific blogs for FLJ25006, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDK-1 Antibody
NB100-2383

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FLJ25006 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK494