FIBCD1 Antibody


Western Blot: FIBCD1 Antibody [NBP1-91362] - Human Lung lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: FIBCD1 Antibody [NBP1-91362] - SampleType : Adult mouse cortex Dilution : 1: 750 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1: 1000 Color/Signal Descriptions : Red: Fibcd1 more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FIBCD1 Antibody Summary

Synthetic peptide directed towards the C terminal of human FIBCD1. Peptide sequence DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FIBCD1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FIBCD1 Antibody

  • FIBCD1
  • fibrinogen C domain containing 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for FIBCD1 Antibody (NBP1-91362) (0)

There are no publications for FIBCD1 Antibody (NBP1-91362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIBCD1 Antibody (NBP1-91362) (0)

There are no reviews for FIBCD1 Antibody (NBP1-91362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FIBCD1 Antibody (NBP1-91362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FIBCD1 Products

Bioinformatics Tool for FIBCD1 Antibody (NBP1-91362)

Discover related pathways, diseases and genes to FIBCD1 Antibody (NBP1-91362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FIBCD1 Antibody (NBP1-91362)

View related products by pathway.

PTMs for FIBCD1 Antibody (NBP1-91362)

Learn more about PTMs related to FIBCD1 Antibody (NBP1-91362).

Blogs on FIBCD1

There are no specific blogs for FIBCD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FIBCD1 Antibody and receive a gift card or discount.


Gene Symbol FIBCD1