FIBCD1 Antibody

Images

 
Western Blot: FIBCD1 Antibody [NBP1-91362] - Human Lung lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: FIBCD1 Antibody [NBP1-91362] - SampleType : Adult mouse cortex Dilution : 1: 750 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1: 1000 Color/Signal Descriptions : Red: Fibcd1 ...read more

Product Details

Summary
Reactivity Hu, Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, ZeSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FIBCD1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human FIBCD1. Peptide sequence DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY.
Predicted Species
Human (100%), Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Zebrafish (92%), Canine (92%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FIBCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against FIBCD1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FIBCD1 Antibody

  • FIBCD1
  • fibrinogen C domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84705
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for FIBCD1 Antibody (NBP1-91362) (0)

There are no publications for FIBCD1 Antibody (NBP1-91362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIBCD1 Antibody (NBP1-91362) (0)

There are no reviews for FIBCD1 Antibody (NBP1-91362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FIBCD1 Antibody (NBP1-91362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FIBCD1 Products

Bioinformatics Tool for FIBCD1 Antibody (NBP1-91362)

Discover related pathways, diseases and genes to FIBCD1 Antibody (NBP1-91362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FIBCD1 Antibody (NBP1-91362)

View related products by pathway.

PTMs for FIBCD1 Antibody (NBP1-91362)

Learn more about PTMs related to FIBCD1 Antibody (NBP1-91362).

Blogs on FIBCD1

There are no specific blogs for FIBCD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FIBCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FIBCD1
Uniprot