![Western Blot: FIBCD1 Antibody [NBP1-91362] - Human Lung lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/FIBCD1-Antibody-Western-Blot-NBP1-91362-img0002.jpg "Western Blot: FIBCD1 Antibody [NBP1-91362] - Human Lung lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the C terminal of human FIBCD1. Peptide sequence DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FIBCD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against FIBCD1 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.](http://images.novusbio.com/images2/Rpn2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38323-img0004.jpg)
![Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein distribution across tissues to independent antibody NBP2-38324 (B).](http://images.novusbio.com/images2/Rpn2-Antibody-Immunohistochemistry-Paraffin-NBP2-38323-img0005.jpg)
![Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.](http://images.novusbio.com/images2/Rpn2-Antibody-Immunohistochemistry-Paraffin-NBP2-38323-img0006.jpg)
Secondary Antibodies |
Isotype Controls |
Pathways for FIBCD1 Antibody (NBP1-91362)View related products by pathway.
|
PTMs for FIBCD1 Antibody (NBP1-91362)Learn more about PTMs related to FIBCD1 Antibody (NBP1-91362).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: FIBCD1 Antibody [NBP1-91362] - SampleType : Adult mouse cortex Dilution : 1: 750 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1: 1000 Color/Signal Descriptions : Red: Fibcd1 Cyan: Nissl(Neurons) Gene Name : FIBCD1 Submitted by : Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu](http://images.novusbio.com/fullsize2/FIBCD1-Antibody-Immunohistochemistry-NBP1-91362-img0003.jpg "Immunohistochemistry: FIBCD1 Antibody [NBP1-91362] - SampleType : Adult mouse cortex Dilution : 1: 750 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1: 1000 Color/Signal Descriptions : Red: Fibcd1 Cyan: Nissl(Neurons) Gene Name : FIBCD1 Submitted by : Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu")
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/images2/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84705-img0004.jpg)
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/images2/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84705-img0005.jpg)
![Western Blot: Ficolin-1 Antibody [NBP1-84705] - Analysis in control (vector only transfected HEK293T lysate) and FCN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/Ficolin-1-Antibody-Western-Blot-NBP1-84705-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Albumin-Antibody-Immunocytochemistry-Immunofluorescence-NB600-41532-img0003.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. WB image submitted by a verified customer review.](http://images.novusbio.com/images2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")