![Western Blot: FIBCD1 Antibody [NBP1-91362] - Human Lung lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/FIBCD1-Antibody-Western-Blot-NBP1-91362-img0002.jpg "Western Blot: FIBCD1 Antibody [NBP1-91362] - Human Lung lysate, concentration 0.2-1 ug/ml.")
| Reactivity | Hu, Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, ZeSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the C terminal of human FIBCD1. Peptide sequence DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY. |
| Predicted Species | Human (100%), Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Zebrafish (92%), Canine (92%), Equine (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FIBCD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against FIBCD1 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Pathways for FIBCD1 Antibody (NBP1-91362)View related products by pathway.
|
PTMs for FIBCD1 Antibody (NBP1-91362)Learn more about PTMs related to FIBCD1 Antibody (NBP1-91362).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: FIBCD1 Antibody [NBP1-91362] - SampleType : Adult mouse cortex Dilution : 1: 750 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1: 1000 Color/Signal Descriptions : Red: Fibcd1 Cyan: Nissl(Neurons) Gene Name : FIBCD1 Submitted by : Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu](http://images.novusbio.com/fullsize2/FIBCD1-Antibody-Immunohistochemistry-NBP1-91362-img0003.jpg "Immunohistochemistry: FIBCD1 Antibody [NBP1-91362] - SampleType : Adult mouse cortex Dilution : 1: 750 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1: 1000 Color/Signal Descriptions : Red: Fibcd1 Cyan: Nissl(Neurons) Gene Name : FIBCD1 Submitted by : Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu")
![Western Blot: Ficolin-1 Antibody [NBP1-84705] - Analysis in control (vector only transfected HEK293T lysate) and FCN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/Ficolin-1-Antibody-Western-Blot-NBP1-84705-img0007.jpg)
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining in human bone marrow and cerebral cortex tissues using anti-FCN1 antibody. Corresponding FCN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84705-img0006.jpg)
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize2/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84705-img0004.jpg)
![Western Blot: Rpn2 Antibody [NBP2-38323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize2/Rpn2-Antibody-Western-Blot-NBP2-38323-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.](http://images.novusbio.com/fullsize2/Rpn2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38323-img0004.jpg)
![Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human liver.](http://images.novusbio.com/fullsize2/Rpn2-Antibody-Immunohistochemistry-Paraffin-NBP2-38323-img0008.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")