FDX1L Antibody

Western Blot: FDX1L Antibody [NBP1-91896] - Analysis in control (vector only transfected HEK293T lysate) and FDX1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: FDX1L Antibody [NBP1-91896] - Staining of human testis shows moderate nuclear positivity in seminiferus ducts.

Product Discontinued

FDX1L Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLG
• Predicted Species: Mouse (93%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FDX1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FDX1L Antibody

• ferredoxin 1-like
• Ferredoxin-1-like protein
• MGC19604
• MGC74760
• mitochondrial

Background

FDX1L, also known as Adrenodoxin-like protein, mitochondrial, is a 20 kDa 183 amino acid protein, and it is involved in the protein biosynthesis of heme A and Fe/S. This process occurs in several pathways such as the metabolism and Mitochondrial Iron-Sulfur Cluster Biogenesis. Disease research is currently being studied with relation to FDX1L and malaria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FDX1L