FDX1L Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLG |
| Predicted Species |
Mouse (93%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FDX1L |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for FDX1L Antibody
Background
FDX1L, also known as Adrenodoxin-like protein, mitochondrial, is a 20 kDa 183 amino acid protein, and it is involved in the protein biosynthesis of heme A and Fe/S. This process occurs in several pathways such as the metabolism and Mitochondrial Iron-Sulfur Cluster Biogenesis. Disease research is currently being studied with relation to FDX1L and malaria.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: GS, GS, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for FDX1L Antibody (NBP1-91896) (0)
There are no publications for FDX1L Antibody (NBP1-91896).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FDX1L Antibody (NBP1-91896) (0)
There are no reviews for FDX1L Antibody (NBP1-91896).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FDX1L Antibody (NBP1-91896) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FDX1L Products
Blogs on FDX1L