FAM178A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM178A Antibody [NBP2-55821] - Staining of human cell line U-251 MG shows localization to nucleus & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM178A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASKYLAKGTNIYVPSSYHLPKEMKSLKKKHRSPERRKSLFIHENNEKNDRDRGKTNADSKKQTTVAEADIFNNSSRSLS
Specificity
Specificity of human FAM178A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM178A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM178A Recombinant Protein Antigen (NBP2-55821PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FAM178A Antibody

  • family with sequence similarity 178, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H7833-00
Species: Hu
Applications: WB, IP
NBP1-82905
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-55821
Species: Hu
Applications: WB, ICC/IF

Publications for FAM178A Antibody (NBP2-55821) (0)

There are no publications for FAM178A Antibody (NBP2-55821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM178A Antibody (NBP2-55821) (0)

There are no reviews for FAM178A Antibody (NBP2-55821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM178A Antibody (NBP2-55821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FAM178A Antibody (NBP2-55821)

Discover related pathways, diseases and genes to FAM178A Antibody (NBP2-55821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM178A Antibody (NBP2-55821)

Discover more about diseases related to FAM178A Antibody (NBP2-55821).
 

Pathways for FAM178A Antibody (NBP2-55821)

View related products by pathway.

Blogs on FAM178A

There are no specific blogs for FAM178A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM178A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM178A