![Western Blot: FAM173B Antibody [H00134145-B01P] - Analysis of LOC134145 expression in transfected 293T cell line by LOC134145 polyclonal antibody. Lane 1: LOC134145 transfected lysate(25.63 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/FAM173B-Antibody-Western-Blot-H00134145-B01P-img0002.jpg "Western Blot: FAM173B Antibody [H00134145-B01P] - Analysis of LOC134145 expression in transfected 293T cell line by LOC134145 polyclonal antibody. Lane 1: LOC134145 transfected lysate(25.63 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse FAM173B Antibody - Azide and BSA Free (H00134145-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | LOC134145 (NP_954584, 1 a.a. - 233 a.a.) full-length human protein. MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATMKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA |
| Specificity | LOC134145 - hypothetical protein LOC134145, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ATPSCKMT |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FAM173B Antibody (H00134145-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")