Exostosin-like 2/EXTL2 Antibody

Images

 
Western Blot: Exostosin-like 2/EXTL2 Antibody [H00002135-D02P] - Analysis of EXTL2 expression in mouse brain.
Western Blot: Exostosin-like 2/EXTL2 Antibody [H00002135-D02P] - Analysis of EXTL2 expression in Hela S3 NE.
Western Blot: Exostosin-like 2/EXTL2 Antibody [H00002135-D02P] - Analysis of EXTL2 expression in transfected 293T cell line by EXTL2 polyclonal antibody.Lane 1: EXTL2 transfected lysate(32.23 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Exostosin-like 2/EXTL2 Antibody Summary

Immunogen
EXTL2 (AAH36015.1, 39 a.a. - 330 a.a.) full-length human protein. LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXTL2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Exostosin-like 2/EXTL2 Antibody

  • Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
  • alpha-1,4-N-acteylhexosaminyltransferase
  • Alpha-GalNAcT EXTL2
  • EC 2.4.1.223
  • exostoses (multiple)-like 2
  • Exostosin like 2
  • Exostosin-like 2
  • EXTL2
  • EXTR2
  • EXT-related protein 2
  • Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
  • processed exostosin-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF2635
Species: Hu
Applications: WB
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4214
Species: Mu
Applications: WB, IP
NBP2-31985
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91982
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33208
Species: Hu
Applications: WB, ICC/IF
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF2667
Species: Hu
Applications: WB, IHC

Publications for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P) (0)

There are no publications for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P) (0)

There are no reviews for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exostosin-like 2/EXTL2 Products

Bioinformatics Tool for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P)

Discover related pathways, diseases and genes to Exostosin-like 2/EXTL2 Antibody (H00002135-D02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P)

Discover more about diseases related to Exostosin-like 2/EXTL2 Antibody (H00002135-D02P).
 

Pathways for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P)

View related products by pathway.

PTMs for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P)

Learn more about PTMs related to Exostosin-like 2/EXTL2 Antibody (H00002135-D02P).
 

Research Areas for Exostosin-like 2/EXTL2 Antibody (H00002135-D02P)

Find related products by research area.

Blogs on Exostosin-like 2/EXTL2

There are no specific blogs for Exostosin-like 2/EXTL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exostosin-like 2/EXTL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXTL2
Entrez
Uniprot