EPC1 Antibody

Western Blot: EPC1 Antibody [29560002] - This image is specific to animal number Q0820 Dilution: 1:10000

Western Blot: EPC1 Antibody [29560002] - This image is specific to animal number Q0819 Dilution: 1:10000

Product Discontinued

EPC1 Antibody Summary

• Immunogen: This antibody was made against a protein fragment from the Middle Region
• Epitope: SECSVGNRAVTQMPSGMEKEEEQEKHLQEAIAAQQASTSGIQLNHVIPTPKVDRVEDQRYHSTYHNKNKMHRSKYIKVHAWQALERDEPEYDYDTEDEAW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation 1:10-1:500
  • ELISA 1:100-1:2000
  • Western Blot 1:10000
• Application Notes: This antibody is useful in Chromatin Immunoprecipitation, ELISA and Western Blot.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for EPC1 Antibody

• DKFZp781P2312
• enhancer of polycomb 1
• enhancer of polycomb homolog 1 (Drosophila)
• enhancer of polycomb homolog 1
• Epl1

Background

EPC1 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPC1 Antibody (29560002)(2)

Publications using 29560002

• Garrison C, Lastwika K, Zhang Y et al. Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections With Obesity J Proteome Res. 2017-01-06 [PMID: 27769113] (MiAr)
  
  Details:
  Analysis is performed on plasma proteomic data to identify how obesity can alter pathways and to highlight the risk factor for disease in subjects with a high body mass index.
• Rho JH, Lampe PD. High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays J Proteome Res. 2013-05-03 [PMID: 23541305] (MiAr)
  
  Details:
  A novel method using antibody microarrays is used to detect autoantibody-antigen complexes that can potentially be useful for detection and characterization of diseases.

Bioinformatics

• Gene Symbol: EPC1
• Uniprot:
  • Y111B2A.11(C. elegans)