Recombinant Human EIF4E2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human EIF4E2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-245 of Human EIF4E2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
EIF4E2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
52.69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF4E2 GST (N-Term) Protein

  • 4EHP
  • 4E-LP
  • eIF4E type 2
  • eIF-4E type 2
  • EIF4EL3
  • eIF4E-like cap-binding protein
  • eIF4E-like protein 4E-LP
  • eukaryotic translation initiation factor 4E family member 2
  • Eukaryotic translation initiation factor 4E homologous protein
  • eukaryotic translation initiation factor 4E member 2
  • eukaryotic translation initiation factor 4E type 2
  • Eukaryotic translation initiation factor 4E-like 34E-LP
  • IF4e
  • mRNA cap-binding protein 4EHP
  • mRNA cap-binding protein type 3

Background

EIF4E2( AAH05874, 1 a.a. - 246 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-268
Species: Hu, Po
Applications: WB, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04416
Species: Mu, Rt
Applications: WB
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84658
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-75578
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-1162
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-80423
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB600-1049
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EIF4E2 Recombinant Protein (H00009470-P01) (0)

There are no publications for EIF4E2 Recombinant Protein (H00009470-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF4E2 Recombinant Protein (H00009470-P01) (0)

There are no reviews for EIF4E2 Recombinant Protein (H00009470-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF4E2 Recombinant Protein (H00009470-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional EIF4E2 Products

Bioinformatics Tool for EIF4E2 Recombinant Protein (H00009470-P01)

Discover related pathways, diseases and genes to EIF4E2 Recombinant Protein (H00009470-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF4E2 Recombinant Protein (H00009470-P01)

Discover more about diseases related to EIF4E2 Recombinant Protein (H00009470-P01).
 

Pathways for EIF4E2 Recombinant Protein (H00009470-P01)

View related products by pathway.

PTMs for EIF4E2 Recombinant Protein (H00009470-P01)

Learn more about PTMs related to EIF4E2 Recombinant Protein (H00009470-P01).
 

Research Areas for EIF4E2 Recombinant Protein (H00009470-P01)

Find related products by research area.

Blogs on EIF4E2

There are no specific blogs for EIF4E2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EIF4E2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4E2